Conserved Protein Domain Family
methan_mark_8

?
TIGR03275: methan_mark_8 
putative methanogenesis marker protein 8
Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it.
Statistics
?
PSSM-Id: 132318
View PSSM: TIGR03275
Aligned: 8 rows
Threshold Bit Score: 385.228
Threshold Setting Gi: 499328030
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011171588   6 HVMEVLGNA--KVTVKNG--KVVDVSDPIISFCPLFAKHRG-INEINKESIQKNVEFRIESFGLFTKNRVVLDDSpFVGF 80  Methanococcus m...
WP_011034769   3 HIMELLGKT--RVVVKDG--KVIEVGEPEVKWCPLFAKIRG-IQKITPDEVRKNMEFRISDFGMFTDKRRLELED-FVGF 76  Methanosarcina ...
WP_011449715   4 HIIEAAGRC--RVVVRDG--KVVEVGSPLITECPLARRFACpVNEMTSEAIRDNIQNRIDSFGMCTPGRELTSDEvFVGF 79  Methanospirillu...
WP_011034766   3 HIMEMMGKA--RVVVKDG--KVIEVGIPEVEWCPLFVKLRG-VEKMTPDEIRKNMEARISELGMFTENRRLEFETtVVAF 77  Methanosarcina ...
WP_011405843   6 HVIEALGKT--RVTIENG--KVSNVEKPLIEYCPIFAKYRN-IEEITPELVRENIQFRIDDFGMCTKNRQIKMSD-MLSV 79  Methanosphaera ...
WP_010869546   4 HVMEALGKA--RVVVENG--RVVEVTEPKIKYCPLFAKHRG-IKEITKESIKENIEFRIKDFGLFTKNRVVEESRyIVPF 78  Methanocaldococ...
WP_010877182   7 HVIEALGKS--RVTVRNG--RVVDVSEPLIDYCPLFHKYRG-IEKITSEAIRQNIEFRIKDFGMCTGNRELRMRD-FLSF 80  Methanothermoba...
WP_011018522   6 HMMECLGKTpvRVIWKDGdvEVRAEGDPMIERCPLMRRREG-FSKLTREAAERHVLNKVNEVGMFTPKRRIRSCRrYTPF 84  Methanopyrus ka...
WP_011171588  81 GTSEIFMSALKKGFLDAVVVVSDCAGTVVTNNPKLVQGLCGRISGIIQTTPIKEVIEKIEKANGIVLSKDDASIDQINGV 160 Methanococcus m...
WP_011034769  77 GASEVMMTGLSRGLLDTTVTACEGAGTVISNNPTLVQGMGGRMSGLVETEPIEGIINGITERGGIVLDPSTAKMDPAAGV 156 Methanosarcina ...
WP_011449715  80 GASEIISTALKSRFIDAAVIVCDGAGTVVVTKPEMAQGIGGRMSGLISTSPIPDVIRRIEDEGGIVVDPDHAFLDPIAGV 159 Methanospirillu...
WP_011034766  78 GASEIMMSGLTSGFLETTVTACDGAGTVISGNPALVQGIGGRMSGLIETEPIDALIRGIEERGGTVLDPATATIDPAGGV 157 Methanosarcina ...
WP_011405843  80 GISEILRSNLEVGNIDCVVGACEGVGTLLMTDADIVQGVGGRASGLVSTTPIPEVMEKIGIEN--VLDAQTAQLNPIKGL 157 Methanosphaera ...
WP_010869546  79 GASEILMSALKRKAIDVAVIVADCAGTIITSNPNLVQGLCGRISGIIETSPILEVIEKIEKAGGVVLNKKTAEINQFEGV 158 Methanocaldococ...
WP_010877182  81 GISEIISTLIEEGEVDAAVMVCDGAGTVIVTEPELAQGIGGRISGVVETSPEDEVIGSIGPEK--VLDPEKATIDQVKGV 158 Methanothermoba...
WP_011018522  85 GVSETLMTCLQHRLIDAAVIVSDCAGTVVTDKPAIVQGLCGEISGIRDTDPIPEVVDRLEDSGCSVL----GRIDQREGV 160 Methanopyrus ka...
WP_011171588 161 KLAIKLGYKKIGVSVSNLKDALEIKKLEKN-DIKIITFGVHTTGIGLSDYDEYLQYIDLISACASKNLLKSKSFniKAQA 239 Methanococcus m...
WP_011034769 157 KKAAELGYKKIAVTVAFAETAKEVRKLESElGLDLIVIGVHVTGLDREEAQALVENSDIVTSCASKSIRDLVKP--LAQV 234 Methanosarcina ...
WP_011449715 160 RAAKMAGYEHLIVTIHNPEDARAIREYDS----DAIIIAVHTTGYSHEDAEKVKQYADIVTACASQTIREICGPcaILQA 235 Methanospirillu...
WP_011034766 158 RKAAELGYKKIAVTIADAKTAKNVRKIESEsGLDLFVIAVHVTGISREEAQELLDNSDIVISCASKYIRELAKP--LVQV 235 Methanosarcina ...
WP_011405843 158 EKAINEGYKNIAITILPSPLIKKIREYDLPsDVNVYLFVAHTTGISMDETKDVFKYADIVTSCASKNIRDYASKikPYYY 237 Methanosphaera ...
WP_010869546 159 KKAIELDYKKIAVTVTNLEDAKRCKSLEND-EIKILTFGVHLTGI--EGSEEIAKYFDLVTACASKVLREKLKGkiKAQI 235 Methanocaldococ...
WP_010877182 159 ERAFEMGYDRVAVTVADPAEAERLREMD---GGEIYIFAVHLTGIDYRGAEKVINTADVVTSCASKYIRRIADRraLLKV 235 Methanothermoba...
WP_011018522 161 EIALEEGRRFVAVTVADAGDAEAIRE---EfGDDVLIAAVHTTGTDEEDAERLVQYCDIITGCASKAVRRAAGRryILKV 237 Methanopyrus ka...
WP_011171588 240 GSGVPIFALSNSGKELLFERLKEI 263 Methanococcus maripaludis
WP_011034769 235 GTAVPLFALTQKGKELVIERAKDI 258 Methanosarcina mazei
WP_011449715 236 GSTVPVYALTSGGKHLILLRMAAI 259 Methanospirillum hungatei
WP_011034766 236 AAAIPLFALTKKGKELVIERAKDI 259 Methanosarcina mazei
WP_011405843 238 GSSVPIYAVSDMGRKFLDTRLEKI 261 Methanosphaera stadtmanae
WP_010869546 236 GKTIPIFALSDFGKEILLERAKDL 259 Methanocaldococcus jannaschii
WP_010877182 236 GSAIPVYACTKNGKRFIELRIKRM 259 Methanothermobacter thermautotrophicus
WP_011018522 238 GSRVPVYGITPAGAEALWLNVREL 261 Methanopyrus kandleri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap