Conserved Protein Domain Family
methan_mark_7

?
TIGR03274: methan_mark_7 
putative methanogenesis marker protein 7
Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it.
Statistics
?
PSSM-Id: 132317
View PSSM: TIGR03274
Aligned: 6 rows
Threshold Bit Score: 439.159
Threshold Setting Gi: 499328461
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011449268   3 LVPITYKGGVFRHDEILDLIEDMGGYIIQKHMIAQEVVLQALIPKEDIEILKTVSRPLAGEVKPAPLVGTEIAVVSMSLE 82  Methanospirillu...
WP_010876804   2 YETLTYQGGVHRHEEMKELIEDLGGFVLQENMLQMDLILTLAVPIDDVDKVREKARELLGKIKVAPMAGTEIAIVSPTLA 81  Methanothermoba...
WP_011405894   2 YETMTYTGGVHKHYEIEELIEDLGGFILQKNESQIDITLTIAVPSEDTDKIEAKAKELLGSVELSPLASTEIAVVSPTLA 81  Methanosphaera ...
WP_011032867   4 LLPYLYTGGVHKHGLLIELMEDLGGYIIQKVVTGTEVNLIMLVPEKDVDIVKKLSKELLGILVEAPLTGVEIAVVSPTLA 83  Methanosarcina ...
WP_010869586   6 YEIVRYEGGVYKNNIFKEWIEDIGGFVIQEHVMQLDVYMTLAIPQNELENIKEEAKKYKGKIIETPLAGTEIAVVAPSLS 85  Methanocaldococ...
WP_011018953   7 FETVIYEGGVYKADEMRDLVEDLGGFVLSEHQMQLEVHMVLAVPVDDLDVIERKAEELLGEIRRMPLAGTEIAVVGMSLA 86  Methanopyrus ka...
WP_011449268  83 IHHLPHASCDVAEYLRTAGAKTNMIGLARGFGKRIGLLSDEERDIINEHDLAIYLFGNFETCI-KEKMPTFRRgI-QVPI 160 Methanospirillu...
WP_010876804  82 RHHLPHSACDISEYLRRYGAKDNMIGLARGAGKGISRISEDEKRLIEEHDLAVFALGSFEQCI-KDKVHLFSD-I-KIPV 158 Methanothermoba...
WP_011405894  82 RQHLPHAACDIAEYLRRYGTKTNMIGLARGAGKGIAQINKEEKDLIEEHDLAIFSLGSFDDCI-RKKKFLFED-I-DIPV 158 Methanosphaera ...
WP_011032867  84 SHHLPHSACDVAEYLRHPGANTNMLGLARGMGRRVSLSMDYERKLINEHDIAVFTFGSFSDCItKKKPKLFEG-I-EIPI 161 Methanosarcina ...
WP_010869586  86 RHHLPHTACDISEYLRRFGAKPNMIGLARGVGRDIAQLREKERRLIEEHDLAVYVMGNFEDCI-KNKTHLF-D-V-DIPV 161 Methanocaldococ...
WP_011018953  87 RHHMPHPVCDIAEYLRRHGAKSNVIGLARGYGRELAQLRTREKRLLEEHDLVIFVVGNFKDCIeKYKLPLVRR-IeRVPV 165 Methanopyrus ka...
WP_011449268 161 VVCGGPTKETLMKIidPPVAGYIGGLGRFMHRTKEPHELARLDEIVEEVSRVIDQKRIGIAKDPLSVTPARLMDIILENV 240 Methanospirillu...
WP_010876804 159 VVTGSPDEIDLRDL--PGADAYVGGLGRIPRRLKRGEDIRALRKLVEVVEGLLDKRSRDMAADPPLVPSILVKSEIENQV 236 Methanothermoba...
WP_011405894 159 IVTGSPEIVA--EE--INANAYVAGFGRIPRRLKRGENIRALKKLVKTSEDIISKQKEELSDDPLIISPVIVKITLEREL 234 Methanosphaera ...
WP_011032867 162 VVTGGPSDLKTEDI--QGADLYVGNIGRVSHRLRRTEEVNALENLNQEVSKIADSIRKQQARDPLAVLPARVMKEIENQV 239 Methanosarcina ...
WP_010869586 162 VVTGGPEKIDI-PY--P----YVGNLGRRSHRLRHGEEIRALRKMVEVITELINERRRELSYDPPIVPPVVVKDEIEKQV 234 Methanocaldococ...
WP_011018953 166 VVVGGPEEIDADDV--V----YVGGIGRKPYRFRKGREITKLDEIVDVVSKIIEERRQELAEDPPVVPPMVVKDRINREL 239 Methanopyrus ka...
WP_011449268 241 PAIHEVTSPIPVVVQMDGTRIKLPYDPYAAEIREIEI-EaGIRIADVCDIRPSRMRDYILLKVKPFSET 308 Methanospirillum hungatei
WP_010876804 237 PAIKEVYSPTPVTSQLDGVRVKLNYDRYHEEIADVRV-S-DYRLGDISEIRKSMMYDYILVKLLPESSV 303 Methanothermobacter therma...
WP_011405894 235 PSIKDVNAPMAIVSQLDGVRVKLPYDEYYKEVANVVV-E-GYRLGDIAEIKKSKMYDHILVKILPETSI 301 Methanosphaera stadtmanae
WP_011032867 240 PEIRTVLSPAPLTLQLDGVRVKLPYDQFHEKIEKLEFdE-GVTLSELANISRSKMKNYILIKIKSKSDI 307 Methanosarcina mazei
WP_010869586 235 EEVYSILSPMPIVTQLDGLRVKLDYDKYADKIREVKV-K-NYTLGDIADIKRSEMKNYILIKIKPKSEV 301 Methanocaldococcus jannaschii
WP_011018953 240 KIEERFTSPMPITLQLDGLRVKAPYDEWADRVAEVEV-F-GWKLREIADIRRSEMDDHILVKIRPKSAV 306 Methanopyrus kandleri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap