Conserved Protein Domain Family
methan_mark_5

?
TIGR03271: methan_mark_5 
putative methanogenesis marker protein 5
Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132315
View PSSM: TIGR03271
Aligned: 6 rows
Threshold Bit Score: 245.01
Threshold Setting Gi: 499725876
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011018949   6 RVFIHPPNSLILHDLVERFGHEPLSLPKEISKRVRDPEIDSPPMNVTPQDAKRGLKYAAVEVPSGVRGRLALIGPLIEKA 85  Methanopyrus ka...
WP_011499930   3 KVIIYPTNSLILSDMVERFGHEPLAMMEKIKEIINTIGVDSPPLNITPEGPKHGLKYAAVEVPAGVRGRMSLIGPMIDFA 82  Methanococcoide...
WP_010877470   2 KIAIFPPNSLILADLVERRGHEPLVIQKEIKKKVTDPEIDSPPFNITEEDPIRGLKYAAIEVPSGVRGRMSIFGPLIEEA 81  Methanothermoba...
WP_010869903   3 KIFIYPPNSLILTDLVERFGHKPLNLNIVIGKLVRNPEIDSPPMNITDEEPKKGLKYAAVEVPSGVRGRMALIGPLIEEA 82  Methanocaldococ...
WP_011449271   3 EVFIYPATSLILSDLVARFGHKPLGTALSVRERIQTAGLDSPPLQMTPDDAKKGLRWAAVEVPSGVRGRMSLFGPLIDRA 82  Methanospirillu...
WP_011406610   2 KVAIFPPNSMILADMVVRCGHEPLVVQKQMKQKVTSPDIDAPPFNMTEDDPISGLKYAAIEVPSGVRGRMSLFGPIIEEA 81  Methanosphaera ...
WP_011018949  86 DAAIVVTGiEDFSFGCLGCDRTNEFVTYLVRRQGIPVLELEYPKSEEEAKAFVREIRDFLESL 148 Methanopyrus kandleri
WP_011499930  83 EAGIIVGD-SSFSFGCMGCARTNELTKFLIREKDIPILEIQYPHTEEDGQDFVYKIADFLKSL 144 Methanococcoides burtonii
WP_010877470  82 DAAIIMEE-APFGFGCIGCARTNELCVFQLRKRGIPTLELKYPRTREETIDVVNKINNFLDEL 143 Methanothermobacter thermautotro...
WP_010869903  83 EAAIIMDD-APIAFGCIGCQRTNELTLYLVRRKNIPILRVKYPTNEEEAEILVNKIANFLKSL 144 Methanocaldococcus jannaschii
WP_011449271  83 EAAIIVRN-PDFAFGCMGCARTDELVEFLVKQKKVPILELDYPADEEEGIIFVRRVKEFLTGL 144 Methanospirillum hungatei
WP_011406610  82 EAAIIMNE-APYGFGCVGCARSSELTVFSLRRKDIPVLELDYPTSRDATVEMVHKINTFLDNL 143 Methanosphaera stadtmanae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap