Conserved Protein Domain Family
met_CoM_red_A2

?
TIGR03269: met_CoM_red_A2 
methyl coenzyme M reductase system, component A2
The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132313
View PSSM: TIGR03269
Aligned: 5 rows
Threshold Bit Score: 915.344
Threshold Setting Gi: 499329309
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011032861   5 IEVKNLTVDFDGLKALKNVNLKINEGEVVGILGKSGSGKTILMHVLRGTESFENISGEVIYHLARCEKCGYIERPSRVGQ 84  Methanosarcina ...
WP_010876646  14 IKLENVTKKFKGVEVLRDISVEIDEGKVLGILGRSGAGKSVLINMLRGMKEYRPDSGRVIYNVAICPECLRVEPPSFDGR 93  Methanothermoba...
WP_010870754   9 LEVKNVTKKFGDKVVLKNISFTLEEGESLGILGKSGAGKSVLLHMLRGMDGYEPTEGQIIYHVSYCEKCGYVDVPSKAGT 88  Methanocaldococ...
WP_011449274   5 ITVDNLTMAFDGKEVLKNISFTLEEGEILGIIGRSGAGKTVLMHLLRGVDQ-PPTSGKIIYHMALCESCEYVGIQSKVGE 83  Methanospirillu...
WP_011019801   5 IRVEDLVKEFEDFR-LEIPELEIGEGEVLGVLGESGAGKSVFIHVLKGLDDYEPDEGRILYRVGMCPECGWIERPEFIGE 83  Methanopyrus ka...
WP_011032861  85 KCPvCG-ETLESFKADFIKLSlyDPVRKDITKRIAIMLQRTFALYGDERVLVNVINSLNEIGYKGddAMKKAVELLEEVN 163 Methanosarcina ...
WP_010876646  94 NCS-CG-SSFALEEVDFWNCD--KKIFAAVRRRIAIMLQRTFALYEDDTVIDNVIKSMPELEYEA--ALYRALELLEMTQ 167 Methanothermoba...
WP_010870754  89 PCKkCG-NELKKIEVDFWN-D--KKYTYNLKRKIAIMLQRTFALYGEKTVLENILEALHQAGYEGkeAIDMALKLIKMVK 164 Methanocaldococ...
WP_011449274  84 PCPvCG-GTMTPQDIDFWDPAn-EALKRRIMKRNAIMFQRTFALYGNDRVIDNVLRALEDIGYPAkkSVGRAADLIDQVH 161 Methanospirillu...
WP_011019801  84 QCPkCEkGKLEEEVVDLWGLS--DTERRRFRKRIAIMFQRTFALYEEQTVLENVMEALEEAGYSGeeAVQRAVDLIEMVQ 161 Methanopyrus ka...
WP_011032861 164 LSHRMMHVARELSGGEKQRVVLARQLVRNPLLLLADEPTGTLDPMTAKLVHEAIIKAVKNYDMSMVLTSHWPEVIEKLAD 243 Methanosarcina ...
WP_010876646 168 MGHRITHIARDLSGGEKQRVVLARQLAKEPMLFLADEPTGTLDPQTAELIHDALLEGVKDKGITMIITSHWPEVMSDLSD 247 Methanothermoba...
WP_010870754 165 LEHRITHIARDLSGGEKQRVVLARQIAKEPFIFLADEPTGTLDPQTAKLVHSALKELVIKNKISLILTSHWPEVIAELTE 244 Methanocaldococ...
WP_011449274 162 LSHRMMHIARDLSGGEKQRVVLARQLAKEPFCLFADEPTGTLDPKTANLVHNMLEAAAKASNMSMVVTSHFTQILEDVVT 241 Methanospirillu...
WP_011019801 162 LEHRITHLARDLSGGEKQRVVLIRQLAKKPIVFLADEPTGTLDPETADIVHKALREGVKEEGITMVITSHWPEVIEDISD 241 Methanopyrus ka...
WP_011032861 244 KAILLENGEVVQEGNPLEVSAVFMQSASMVRQ-DRNVLVGEPIIRVRNLSKRYISVDRGVVRAVDNISFEVKEGEIFGLV 322 Methanosarcina ...
WP_010876646 248 YAIWIEKGEIVEEGDPDTVVARFMEQVPAPEK-AKEFEQENPIIKMVDVKKHYYSIDRGVVKAVDGVDLTVYEGEIFGVV 326 Methanothermoba...
WP_010870754 245 KAIWLDKGEIIMEGTSEEVVNKFMETVKEFKKpETEVEIKEDIIKLENVSKHYCSVERGVIKAVDNVTLNIREREIFGLV 324 Methanocaldococ...
WP_011449274 242 RAILLENGAIKKIGTPDEVIEVFMEGFSDLEK-FCEIELGKEILKTRELSKRYISVDRGLIKAVDSVQFEVFHKEIFGII 320 Methanospirillu...
WP_011019801 242 KAVWLEDGCVKEVGEPSEVVSKYLELVEEVER-EEV-EVGDDIIRVKDVKKYYYSIERGVVKAVDGVSLDVKEAEVYGIV 319 Methanopyrus ka...
WP_011032861 323 GVSGAGKTTTSKILMGILPPTSGEVEVRIGDEWVDMTKLGVDNKGRATKYMGFLHQEYGLYTHSSVIDNLTESISLDLPF 402 Methanosarcina ...
WP_010876646 327 GLSGAGKTTLSRIIIGITEPSSGKVCVRLGDEWIDMTEKGPLGRGRVTPYLGILHQEYSLYPHRDVLGNLTEAISLELPD 406 Methanothermoba...
WP_010870754 325 GTSGAGKTTLAKIIAGVLPPSKGKYWFRVGDEWVDMTKPGPMGRGRAKRYIGILFQEYALYPHRTILENLTEAIGLELPD 404 Methanocaldococ...
WP_011449274 321 GTSGAGKTTLSKMIAGVIEPTAGELNVLVGEDWVDMTKPGFDLRGRAKQYIGLLHQEYDLFPHRTILDNLTDAIGLEFPK 400 Methanospirillu...
WP_011019801 320 GKSGAGKTTLAKILAGVLEPTEGEVYVRVGDDWVDMTDRR--ERGRAKRYIGMLHQQYTLYPHRTVLENLTKAIGIELPD 397 Methanopyrus ka...
WP_011032861 403 ELGVRKAVITLKAAGFEEDKAKSILPKMTDEMSEGERHRIALAQVLIKEPRIVIMDEPTGTMDPITKVAVTNSILKAREE 482 Methanosarcina ...
WP_010876646 407 EFAKMRAVYVLKTVGFDDKYAESILNKYPDELSGGERHRVALAQVLIKEPRIIILDEPTGTMDPITRVQVTDSILKAREE 486 Methanothermoba...
WP_010870754 405 EFARMKAVYTLVSVGFSEEEAEEILDKYPHELSVGERHRCALAQVLIKEPRVVILDEPTGTMDPITRNTVAESIHKSRIE 484 Methanocaldococ...
WP_011449274 401 ELAMRKAIITLKMAGFTEEKAREVLERLPSTLSEGERHRVALAQVLIREPHIVVLDEPTGTMDPITKVDVKHSIMHAREE 480 Methanospirillu...
WP_011019801 398 ELARMKAVHVLKVVGFDEKKAVNILDKYPDQLSEGERHRVALAQVLIREPRILILDEPTGTMDPITMRKVAKSILNARKE 477 Methanopyrus ka...
WP_011032861 483 IGETFVIVSHDMDFVNEICDRVALMRDGKIVDIGQPKNVLSQLT 526 Methanosarcina mazei
WP_010876646 487 LNQTFLIISHDMDFVLDVCDRASLMRGGRILKTGDPESIVGDLT 530 Methanothermobacter thermautotrophicus
WP_010870754 485 LEQTYIIVSHDMDFVLNVCDRAGLMRNGKLIKVGKPEEIVALLT 528 Methanocaldococcus jannaschii
WP_011449274 481 MEETFIVVSHDMDFVRDICDRCALMRFGKIVKIGPTAEVLEEIT 524 Methanospirillum hungatei
WP_011019801 478 MNQTFVIVSHDMDFVLMVCDRASLMRDGKFVKTGDPEEIVRELT 521 Methanopyrus kandleri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap