Conserved Protein Domain Family
methan_mark_3

?
TIGR03268: methan_mark_3 
putative methanogenesis marker protein 3
A single member of this protein family is found in each of the first ten complete genome sequences of archaeal methanogens, and nowhere else. This protein family was detected by the method of partial phylogenetic profiling (see Haft, et al., 2006). The functions of proteins in this family are unknown, but their role is likely one essential to methanogenesis. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132312
View PSSM: TIGR03268
Aligned: 6 rows
Threshold Bit Score: 683.778
Threshold Setting Gi: 499328673
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010877467  12 VKVNGEEVELPDGSTVRDALEATGAPYVEGTLVCLISG-T-RELERTIDTYRIRTTTGSILLELL-PDDAP-GivEEWRR 87  Methanothermoba...
WP_011406613   3 VKINDIEMDITAGSTVEDAIKLSNAPYISGTPIALIEG-R-QELESQVNKYKIETTGGSVIIELV-DNAELlT--DFWKK 77  Methanosphaera ...
WP_011032862  10 VEVNGQVYTLPAGSTLGDALKVSRAPYIAGAAIGILKK-AaEKRTEKITEYAINTPKGELRIEIKdPESTS-G--KLWAE 85  Methanosarcina ...
WP_011449273   4 IHFDGTITTVPDGFTIDDLLPDRDRSLC----IGILRP-V-TVSQAETKEFLIKTTAGEVVVETM-PGTCA-G------E 69  Methanospirillu...
WP_010870929   4 VIVNGKE---KVGETLREVIK--DEYYNEGANIVIIKGvK-REAEKIPKKFLIKTTKGNITIAIT-ENNET-A--KFFIN 73  Methanocaldococ...
WP_011019165   3 VYVDGEPVDVPEEATVRDALEAAGVSVPEDVTIAVFKG-E-QKVERETDRLRIMLETGDEELSLT-VAVED----ERMSE 75  Methanopyrus ka...
WP_010877467  88 IYTELENMRIRWTTPSEIAMGPLR-TELE-PSRDEFTYDEDEVIMSLSGFSPDSTHIIISKEPHSAVYGVPRENrGVFAR 165 Methanothermoba...
WP_011406613  78 NYKKFINKVIRWTTSQEVAMGAVK-SDLE-PTNNEYLYNRWDVIISLSGFSNEATHIIFSKSKHQSIYSVPNQNkGIVAT 155 Methanosphaera ...
WP_011032862  86 HYKEYEGKDIHWESPEALAFGPFE-ADIK-PSRETGNFEAFDVLFGAGGFDPHNTHLILSRKRHSAEYGSPDD--GVFAS 161 Methanosarcina ...
WP_011449273  70 ILTGLSGIQSGWHDLQVASFGPFP-SSFT-PSRKPSRYERGDLALGCGGYDPARSFLVFCKKTHAADHGGPVEN-GIIAK 146 Methanospirillu...
WP_010870929  74 NYKDFV-KKLRWVSGMDVAFGSTT-IDLE-ISTEPKEFKKWDVVLSISGLDKDEGHIVFIKKKTEGVYGLKDPK---IGI 147 Methanocaldococ...
WP_011019165  76 VCEELPGASVSWTTRDEVGLGPVDvSDLEfHTRRGVEVPPYTAILILPTNDPSEAYFLITKRRMAVEYICTD----IHGR 151 Methanopyrus ka...
WP_010877467 166 ITGGKRTVERLTQDDVVKSVEPVVERKSIVESAAVTDLNTELEDGNQLFTYVKVK--------PSPESPQSVEHFFSM-- 235 Methanothermoba...
WP_011406613 156 VVGGKRNILKLKNTDEIINIEPIIERKSVINSASVTDLSTTLKEGNELFTYVEIE--------ANHEAPISFEHFLKI-- 225 Methanosphaera ...
WP_011032862 162 IVTGRKIISKISKEDSILSIEPVIEWERITEKTCTTDLSTPLEDEDSVYTYFEVE--------LSRNAPVGAEHFYAL-- 231 Methanosarcina ...
WP_011449273 147 VISGMGVLDRLSDSDQIISIEPVISFAESSDARTTTDGSVVLEEGMHIITHIRVQaegktldgYDPKTAVSVDRMLLA-- 224 Methanospirillu...
WP_010870929 148 VVGGKWVIDRLEVGDKIIDIEPIREEKEAVDYLVTTDLDLKLEDGWRIFTYFTAE--------FD-GTPSAVEHCLAL-- 216 Methanocaldococ...
WP_011019165 152 VTAGRELVDELRGGERVTHVEPVVERATERVVSRVT-LDDGLEAGDRIITRVEIE--------LEKNAPVSAEHLLNTle 222 Methanopyrus ka...
WP_010877467 236 VEDGKLRVDYEANSFIGFYSLQGIKKDPEKIDKRNRGAVTLRNTGRGSGRVYIYREDRVSTPSHNLIGHVTEGMELVDIA 315 Methanothermoba...
WP_011406613 226 IEDGTFYVDYESESFIGNDKLRGLEKDSEVIEKRKRGAVTLRNQGAGVGRVYIYREDRVGVPSHNIIGYVSRGIQLLDTV 305 Methanosphaera ...
WP_011032862 232 TREGTLKVDAVTSSFISDDSLREVPAPYENFEQRREGAISVRTVGYGTGRIYISREERPSSLVHSVVGQVTKGLELIKLA 311 Methanosarcina ...
WP_011449273 225 LLNRVFIVDKRLSTHIRCDVLTGTDVPCEACSGRREGTVLMRTSGKNRGSLYIYTQDLPRSLAHTVVGHVVHGIELCKIA 304 Methanospirillu...
WP_010870929 217 MEDGIFEITENTNTYVADCRLQTLKIEEGNLIDRERGFITVRNYGVGEGKVYIYRESRSSSLSHTVVGRVKEGIELIDFS 296 Methanocaldococ...
WP_011019165 223 MEEGRLRIKFRTDTFTSIEPRPFYDLPEENVDMRERGVVTVRNRGVDEGVVYVYRRDRTPVESHNVVGRVRRGMELLDVV 302 Methanopyrus ka...
WP_010877467 316 GEGDQITVECEPGRIMTVAMTQKEAEDYLREYGIEQIREGIMDDDAIVVVQDPPYTMDILREGKVRTLGIDPDKILEIEL 395 Methanothermoba...
WP_011406613 306 KEHEKITIKTVPEKISTVALTQKDADIYLENLGIEHERDGLVDDDAIIVAQDPLYTVDIDKQKKLKTLGVPKDDFVEIEL 385 Methanosphaera ...
WP_011032862 312 EKGQKLSVESLPPQIVLLGHSFEEVEPLLSSIGVELIKEGYAGENSVIVRQEPPTTLEILGEAKVKAYAVARTKLIEVEL 391 Methanosarcina ...
WP_011449273 305 QEGDRLSIQIEPSQVDLIGLPLAMARERAEALHLTLTPD-VDGPDRVVIKQKPATTLEVLAQGLVEVETIPDKQVISITL 383 Methanospirillu...
WP_010870929 297 DSG-VLSVKXVPERLCAIGLTIEEAEEMFKKYNIEVEKEG-DLENAIVVEQEPEYTLDVLKEKKVKIRGLDKNKIIVIEL 374 Methanocaldococ...
WP_011019165 303 AEGDRVLVETDPPRVNFVGLTVDEARELAEEFDVELEVNG---DGDVVVDQEPRETLNVLKERKVRVEVVPEDEVIEIEL 379 Methanopyrus ka...
WP_010877467 396 -DPAAPRSSWYFRRLTGLIDTPIGSLKVHFAFPG--MkvVMFEGDKSLA--KGLIPENTPERCVKKGNIGITNMSRRHIG 470 Methanothermoba...
WP_011406613 386 yADENPSSVWYFRKISGLLNGDVGHLRVNMAIKE--MniIMFKAVNKEA--KGLIPEKLPDNKVNAWEICVSNTACKHVG 461 Methanosphaera ...
WP_011032862 392 yTEIAPKSIDFFRHALDLKTKTVGKLPVHMIYET--T--YLFKTEKEMVkyKEILPENTPEKKVLAGEIGITNQAAKRMG 467 Methanosarcina ...
WP_011449273 384 dDVNAPRTCKIFREFSGLKYHAVGRLPMLFSFDE--V--TLFKAKIPKT--TNVIPENTPVSSVEAGVLAMTNDSCKGVG 457 Methanospirillu...
WP_010870929 375 fEDKAPITAWYFRKTTGLTTKRVGKLHVYFKHKD--I--VMFKGNPEYA--KGLLPENIPTDKVEPCSIGVTNMVSRYKG 448 Methanocaldococ...
WP_011019165 380 yEDDAPRSVEYFRRVTKMLDRPVGRLKVHFAYADlgM--IVFEGNEKLG--KKLPPENNPKDRVEAGVLGVTNQAKPHAG 455 Methanopyrus ka...
WP_010877467 471 MVGVRLEDNDEYGPTGEPFNGTNMIGKITGGIENVEKLKEGD---TVYVRE 518 Methanothermobacter thermautotrophicus
WP_011406613 462 NIGIRFEDNSEFGPTGESFSATNVIGKVVAGFDNLKAFKEGD---TVYVKE 509 Methanosphaera stadtmanae
WP_011032862 468 TIGVRLIDDDLFGPTGEKFSSTNIIGRIVE-PDRLKGIKEGD---AIYITE 514 Methanosarcina mazei
WP_011449273 458 IVGVRSVPSSEFGPTSEPFSGTNIIGTVID-MEKIAGLEEGE---VVFFRE 504 Methanospirillum hungatei
WP_010870929 449 MIGVRLGESDKFGPTGESFEKTNIVGGIVENAEYLKNVKTGD---DVYVLL 496 Methanocaldococcus jannaschii
WP_011019165 456 LIGVRLEDSEEYGPTGETFEGTNVIGRVVEGLGRLREMDQSDmgrTVYVRE 506 Methanopyrus kandleri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap