Conserved Protein Domain Family
methan_mark_2

?
TIGR03267: methan_mark_2 
putative methanogenesis marker protein 2
A single member of this protein family is found in each of the first ten complete genome sequences of archaeal methanogens, and nowhere else. Sequence similarity to various bacterial proteins is reflected in Pfam models pfam00586 and pfam02769, AIR synthase related protein N-terminal and C-terminal domains, respectively. The functions of proteins in this family are unknown, but their role is likely one essential to methanogenesis. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132311
View PSSM: TIGR03267
Aligned: 4 rows
Threshold Bit Score: 540.558
Threshold Setting Gi: 499328672
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010870145   2 NLKKVVNEIRNFEGILRKIAIKDVVE-TFDFNDEDYEfDIIVDFGDDAAVIGIDGDNAILLAADGIWGKLLEADPWWAGY 80  Methanocaldococ...
WP_010877466   4 DLDDIIHSLKNFEGVTRKRPIKNIVS-ILNDAYNVSG-NTYLGYGDDASAIRIGDGKLLLLAADGIWGRLMDADPYWAGY 81  Methanothermoba...
WP_011032712   2 NLEQLAERIRSFEGVTRKKQIEDIVS-IFEAVRPEYG-NAIVDFGDDAAVIDIGGDDVILFAADGIWGRLLDASPWWAGY 79  Methanosarcina ...
WP_011019164   2 NLRELARELRSFEGVTRKHPVKTVVEgLLEPLDVTFEgEVIADVGEDAAAVKVG-DDILLIAADGIWGKLIDRDPWWAGY 80  Methanopyrus ka...
WP_010870145  81 CSVLVNCKDIAAMGGKCVGMTNIISIKDKDICREVLKGVKDGVKKFGVPMVGGHTHPDAMCNVLDVSITGIAKKDCILRS 160 Methanocaldococ...
WP_010877466  82 CSVLVNVNDIAAMGGKPVGMVNVLSINSSETCYSVMEGIRDGADKFGVPMVGGHVHPDTPYDALDVSIAGIASEDAIITS 161 Methanothermoba...
WP_011032712  80 GAVVVNVNDIAAMGGKPLAMVDIASANSPKACRELMEGLAEGVRKFGVPVVGGHVHPDTKYNSLSVAIIGIVKKDCVIRS 159 Methanosarcina ...
WP_011019164  81 CAVLVNVNDVLAMGGRPVGLVNVLSTSDVDVCREILEGMREGAWKFSTPVLGGHTHPDTPYTAVDAAIVGVTDEEHLVLS 160 Methanopyrus ka...
WP_010870145 161 DNAKIGDKIIFAYDLVGQIYKSFPLNWDTTTMKSKKLVRAQMDALVQIAENKLANSCKDISNPGAIGTLGMLLEVSR-KG 239 Methanocaldococ...
WP_010877466 162 CDARPGDRVIVGIDLDGRPHPSFPLNWDTTTHKSPEDVQAQIDIMAELAERHLVTAGKDISNPGTLGTLGMLLEASN-VG 240 Methanothermoba...
WP_011032712 160 DTAKPGDLVIAAYDMDGKIGPNSPYSWDTTSFKEPSVLRESYLVTQEIAQKKLASAGKDISNPGLIGTLGMLCETSR-VG 238 Methanosarcina ...
WP_011019164 161 STAEEGDLIVFVIDLNGRPYPEYPLNWDTTTMKDPDYLRRQMEAVVEAS--KLVKAGKDVSNPGLVGTLAMMLEASGcLG 238 Methanopyrus ka...
WP_010870145 240 GVVDITKIPKPEEIDLIHWLKVYPGSGYVLTAKEE-NFKEIKDIFEDVEMTAEICGEVIAEKKLYITDGENKEVVFDFEK 318 Methanocaldococ...
WP_010877466 241 ARIEMESIPRNRSVDWDSWLKMYPGSGFVLTAAPE-NVNECVELLESVGITASDAGEIIADQRLYLRVDDDEGVLFDLKS 319 Methanothermoba...
WP_011032712 239 ASVDLEKVPRPEGVDFEQWLKVHPGTGYVFTADPE-KAGECVAVFEKAGLTAAVVGKIEEGLKLDMYDKTGRVTVFDFSK 317 Methanosarcina ...
WP_011019164 239 AEVWLDSIPKPEDVDMVTWLKMYPGMGFVYAVDSErDVRAIRRVLSDARLEVSVIGEVTEDGVVKVSEGDESARVFDFRE 318 Methanopyrus ka...
WP_010870145 319 EFICGC 324 Methanocaldococcus jannaschii
WP_010877466 320 EIITGV 325 Methanothermobacter thermautotrophicus
WP_011032712 318 DSITGI 323 Methanosarcina mazei
WP_011019164 319 DRILGV 324 Methanopyrus kandleri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap