Conserved Protein Domain Family
methan_mark_1

?
TIGR03266: methan_mark_1 
putative methanogenesis marker protein 1
Members of this protein family represent a distinct clade among the larger set of proteins that belong to families TIGR00702 and pfam02624. Proteins from this clade are found in genome sequence if and only if the species sequenced is one of the methanogens. All methanogens belong to the archaea; some but not all of those sequenced are hyperthermophiles. This protein family was detected by the method of partial phylogenetic profiling (see Haft, et al., 2006).
Statistics
?
PSSM-Id: 132310
View PSSM: TIGR03266
Aligned: 9 rows
Threshold Bit Score: 475.383
Threshold Setting Gi: 499327995
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011033404  16 TQRVYDEATTLE--NTKNQIKKIGVTRIADITNLDRLGVPIFSSIRPSAAPG--AISIYSGKGSTEQRARISAIMESFER 91  Methanosarcina ...
WP_011020223  16 TQRVYDEATTLE--NTKDQIKKIGVTRIADITNLDRLGIPIFSAIRPSAAPG--AISIYSGKGSTEQRARISAIMESFER 91  Methanosarcina ...
WP_011305848  16 TQRVYDEATTLE--NTKDEVKKVGVTRLADITNLDRLGIPIFSAIRPSAAKG--AISIYSGKGSTEQRARISAIMESFER 91  Methanosarcina ...
WP_011447574  14 THRTRSPEETYE--AVHDLTGPAGITRVADITGLDRIGIPVFSCIRPVAAEG--AITVYNGKGATPIAARVSAIMEGLER 89  Methanospirillu...
WP_011406735  13 THRTSSPEKTLE--KISKITTDIGLTRTSNITHLDRIKIPVFTSVRPLAKEG--AVSVYAGKGPTEIHAKVSSIMEAVER 88  Methanosphaera ...
WP_011171000  11 AYRICTPEETFE--KIEPIIKEIGVTRTARIDGLDRIGIPVFSSIRPSAKDG--AISVYAGKGATEIQAKVSSTMEAIER 86  Methanococcus m...
WP_010876618   2 HPQAVRPSETLK--AFGDKLSMIGVTRITEITHLDRIGIPVFSAIRPTAEDG--AVSIYAGKGATRTQARASAMMEAFER 77  Methanothermoba...
WP_010870606   9 SYRICSPEETFE--KIQEALKKIETVEIKNIQHLDKVNIPVYYLKRRVVVDGkeGIAIHYGKGANDIQAKVSACMEAIER 86  Methanocaldococ...
WP_011018487  10 GFRAFLPKETLRwiRHRELERKVGVVEKFS----DRVG-PIPVEIRRRRSQY--GEFYHAGKGTTRIQARVSAAMECVER 82  Methanopyrus ka...
WP_011033404  92 CLAERPGLNANIAGdisapalvesylnARENYVTLDPGSLLLSQ----PYNPSSLLEWVGAYDLLNKEEVFVSANAVYHP 167 Methanosarcina ...
WP_011020223  92 CLAERPGVNANIEGgisapalvesysnAQENCNVLDPNSLLLSQ----PFNPGSLLEWVGAYDLMNREEVFVNANAVYHP 167 Methanosarcina ...
WP_011305848  92 CLAEKPGLNTNIKGeisaptlvesytrATESCKVLDPETLLLPQ----PYLPQSLLEWIGAYDLMNNEEVFVSSNSVYHP 167 Methanosarcina ...
WP_011447574  90 YSAEVHDRSPQTMTyd----------qIRMEKNAIRPDTLILPE----YAEPEWPIPWWQGYDILRNEEVWVPAHAVFHP 155 Methanospirillu...
WP_011406735  89 YSAEIQGTENTILE-------------KYNPENCLNPESLILPR----NSYNDNALEWIKGYSIKTSREIYIPANVVFHP 151 Methanosphaera ...
WP_011171000  87 YSAEFDENSKLELT--------------KEPENPINLDDLILPGgksaEYTDTKGIDWVIGKDIISGKSFDVPINSAVHP 152 Methanococcus m...
WP_010876618  78 YSAERKPEDETFTA-------------HPEDCDGLDPESLILPG----STDLKSELEWINAENLTGDEEVPVPANAVFHP 140 Methanothermoba...
WP_010870606  87 FSASYDKNKVK-----------------EKPDNPINVEDLILPQ-----YADKNVKEWVEGIDIINNETIDVPADAVFYP 144 Methanocaldococ...
WP_011018487  83 AAAEP-----------------------REEIIERGPEGDKWTP----AWYRTEPREWVEGVDLTTREPVYVPANEVFHP 135 Methanopyrus ka...
WP_011033404 168 YDSPGQcQKLFLSNTNGLASGNVLEEAILHGLLEVIERDAISTAQFTRDLGKEIVL-TEEDGYLYEISRKFKDSGIDLKI 246 Methanosarcina ...
WP_011020223 168 YDAPGQcQKLFLSNTNGLASGNVLEEAILHGLLEVIERDAISTAQFTRNLGKEIVL-TEEDGYLYELARKFKDTGIDLKI 246 Methanosarcina ...
WP_011305848 168 YDSPGQcQKLFLSNTNGLASGNVIEEAILHGLLEVIERDAISIAQFSRNLGKEIVL-TEEDGYLYELASKFKDAGIELKI 246 Methanosarcina ...
WP_011447574 156 --VPRImGKLFRTSTNGIASGNTYEEAVFHSLCELIERDAWSLVEASQNAGPAIT--DVTHPVARELLDKFKEAGVDVIL 231 Methanospirillu...
WP_011406735 152 YTTEDV-HHICLSNTNGLASGNTIEEAIFHGMMEVVERDAWSLFEAFKENKPEINCkNATNEYVCELIEKFRNANVYIKL 230 Methanosphaera ...
WP_011171000 153 HDG----KKLFRSNTNGLASGNSEEEAVFHGMLEVIERDAWSISELSKNTYRKVNVeNAKNPLIFELLEKFKKAKINIIL 228 Methanococcus m...
WP_010876618 141 YNPPEGcMSLFRSNTNGLASGNAREEAIFHGLMEVIERDAWSLFEARRGPKVEVDCsGTDNDIISGLLEKFHAAGVEVTL 220 Methanothermoba...
WP_010870606 145 TS-----GKLFRGNTNGLASGNNLDEAILHATLEIIERDAWSLADLARKIPTKINPeDAKNPLIHELIEKYEKAGVKIIL 219 Methanocaldococ...
WP_011018487 136 WL-----GDALPSHTNGLSAGRLREEAVIQGLLEVVERDSWSIVEYFRIHPPELEV----HGELEELRRSLEREVGRVEL 206 Methanopyrus ka...
WP_011033404 247 WLVPTDT-GIPTIIAATDDVKLKDPALLVMGAGSHLKPEIAVARAITEAAQSRVVQIQGAREDTD-R--EGFIR--SVGY 320 Methanosarcina ...
WP_011020223 247 WLVPTDT-GIPTIIAATDDVKLKDPALLVMGAGSHLKPEIAIARAITEAAQSRVVQIQGAREDTD-R--EGFIR--SVGY 320 Methanosarcina ...
WP_011305848 247 WLVPSDT-GIPTVIAVTDDVKLKDPALLVMGAGSHLKPEIAVSRAITEAAQSRLVQIQGAREDTD-R--EGFIR--SVGY 320 Methanosarcina ...
WP_011447574 232 RDITSDL-GIPTVAAVSDDLQLRDPTLLCIGMGSHLCSEIAILRALTEVAQSRATQIHGAREDTK-T--THFLS--KVGY 305 Methanospirillu...
WP_011406735 231 LDLTSDN-DIPTIGAVSEDLTLKDPALLTLGIGTHLDANIAAIRAITEVAQSRATQIHGTREDTT-R--ANLLR--DTGY 304 Methanosphaera ...
WP_011171000 229 KDLTSEV-GIPTVAAISDDDVLKDPALLCMGVGCHLHPEIAVLRALTEVAQSRATQIHGAREDTN-R--GDVVR--KISY 302 Methanococcus m...
WP_010876618 221 VDLTADT-GVATVAAVADDTVLRDPALLTMGVGTHLDPEIAVIRALTEVAQSRATQIHGTREDTV-R--AEFMR--RAGY 294 Methanothermoba...
WP_010870606 220 KDLTSEF-EIPVVAAISDDLS-KNPLMLCVGVGCHLHPEIAILRALTEVAQSRASQLHGFRRDAKlR--EEFTS--KIPY 293 Methanocaldococ...
WP_011018487 207 RLLPSRVeGVYVVGAVTEAERVEE---MVMGFGASPDPEMAVLRALLEVAQGLSMARRGIESPVR-KglGEFSApgKLTP 282 Methanopyrus ka...
WP_011033404 321 DRMKRLNWFWF-EEGEKISLSEVQDISKRSPAENI-DVILEKLK--GLtEKVLVVDLSREEVAVPVVRVIIPGFELFTID 396 Methanosarcina ...
WP_011020223 321 DRMKRLNWFWF-EEGEKISLSEVKDLSGKSPTENI-DIILEQLK--GLtEKVIVVDLSREEIAVPVVRVIIPGFELFTID 396 Methanosarcina ...
WP_011305848 321 ERMKRLNWFWF-EDGEKISLSEVQDLSRKSPAENI-DVILEKLK--GLaKRVLVVDLSREEVKVPVVRVIIPGFELFTID 396 Methanosarcina ...
WP_011447574 306 DRAKRLNKKWF-TTEAEIAYKDMPSYHTDDFLDDI-HIVLDRLKaaGL-DRVIVHDLTRPEIGVPVVRVIVPGLEHYAMD 382 Methanospirillu...
WP_011406735 305 DRMKRINRHWFrKSDETINIEDIPDKSKNSFKEDI-ELTMKLLEktGI-KDAYYVDLTR-DINIPVVRVIIPGMELFSVD 381 Methanosphaera ...
WP_011171000 303 DRMKRAHKKWY-TFKNEINIEDMPNNAKLNLKKDI-ETVKEILKqnGF-DKIITVKLNK--TDIDVSRVIIPKMEMYSVD 377 Methanococcus m...
WP_010876618 295 ERMKRLNRHWFsEPEDTITLDEMEDLSTRSFRGDL-EITLRKLResGL-EDVFYVDLTR-DVGVPVVRVIVPGLEVFSVD 371 Methanothermoba...
WP_010870606 294 ERLKRIHRKWF-EFEGEINIADMPNNARYDLKKDL-KFIKDKLSefGF-DKLIYVDLNK--VGVDAVRVIIPKMEVYTID 368 Methanocaldococ...
WP_011018487 283 ERLKRLNRHWF-EPEGTVEIDDLDRVITTGSLEKLtEELVERVAeaGL-GKVIEVDLTLENLDVPVVRVRVTGASEYVID 360 Methanopyrus ka...
WP_011033404 397 RDRKGKRL 404 Methanosarcina mazei
WP_011020223 397 RDRKGQRI 404 Methanosarcina acetivorans
WP_011305848 397 RDRKGKRI 404 Methanosarcina barkeri
WP_011447574 383 PERIGERC 390 Methanospirillum hungatei
WP_011406735 382 SSRVGNRL 389 Methanosphaera stadtmanae
WP_011171000 378 RDRISLWI 385 Methanococcus maripaludis
WP_010876618 372 PERVGRRI 379 Methanothermobacter thermautotrophicus
WP_010870606 369 RDRLSRRA 376 Methanocaldococcus jannaschii
WP_011018487 361 EARVGNMP 368 Methanopyrus kandleri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap