Conserved Protein Domain Family
met_CoM_red_C

?
TIGR03264: met_CoM_red_C 
methyl-coenzyme M reductase I operon protein C
Members of this protein family are protein C, a non-structural protein, of the operon for methyl coenzyme M reductase, also called coenzyme-B sulfoethylthiotransferase (EC 2.8.4.1). That enzyme, with alpha, beta, and gamma subunits, catalyzes the last step in methanogenesis; it has several modified sites, so accessory proteins are expected. Several methanogens have encode two such enzymes, designated I and II; this protein occurs only operons of type I. The precise function is unknown. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132308
View PSSM: TIGR03264
Aligned: 7 rows
Threshold Bit Score: 299.35
Threshold Setting Gi: 499343652
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011449110   4 GRVTQVVDCRESAGMGKGGALAQRGTISECRYPDVIIIGMSPGRRHVTKPVCDITSALRAQGVEysISTMILNAGSGIPP 83  Methanospirillu...
WP_010870358   4 GRREQIVDCRSVMGLGEGGGLAQRGTFAEALKNDVVVVAMSPGRRHITKPVCEITYGIREAGIQ--TSVLVLNAGSGIPH 81  Methanocaldococ...
WP_011171501   4 GRKEQIVDCRAVMGLGEGGGLAQRGTFAEGLRNDVVVVAMSPGRRHITKPVCEITYGIREAGIQ--TSVLVLDAGGGIPS 81  Methanococcus m...
WP_011405909   6 GKNTHIVDCRETRGIGEGGGIAQRGTYAQCG-DELLAVAMSPGRRHITKPVCEITFALRESNIQ--TSTLVLNAGSGVPK 82  Methanosphaera ...
WP_010876790   3 GKCTHVVDCRETMGMGEGGGIAQRGTFAQCG-SEVLAVAMSPGRRHITKPVCEITFALREANIM--TSTIVLNAGAGVPQ 79  Methanothermoba...
WP_011019023   2 GRETYAVDCRAAMGMGKGGSLAQRGTIAETEITEVVAVAMSPGSRHITKPVCEITYALREAGIH--TSVLVLNAGSGVPA 79  Methanopyrus ka...
WP_011033191   4 DRETQVVDCRCGGGLGKGGGLAQRGTLSEAGRADVVAVAMSPGQRHITKPVCEITYGMRKENIQ--VSVLVLYSGSGIPE 81  Methanosarcina ...
WP_011449110  84 DAPKSAGhvlGAYFGLNEKEIIQVNRHKVAVLHHGNVRSHIVHKVRSILKDCDIPAVVVCQAPVDYEDFAKEGVKTAFVM 163 Methanospirillu...
WP_010870358  82 DAPRGAL---GSTFGIKPEEAEQINRHKLCVVHFGNVISHIVYKAGLLLKYVEIPTIIVCQAPVDMEDLAKYGIKTRDVM 158 Methanocaldococ...
WP_011171501  82 DAPQGSL---GSTFGLKPEEAKQVNRHKLCVIHFGNVKSHIIYKARLFLKYVDIPTIIVCQTPVDMEDFAAIGIKTKNVM 158 Methanococcus m...
WP_011405909  83 DTPSGGG---QGLFGVTPKEISQMSRHNIVLFHFGGVKNHIIYKAKHALKHINKPVIIIAQYPLDFEDFAKIGVNTVAVK 159 Methanosphaera ...
WP_010876790  80 DAPSAGA---GSLFGLTPAEVEQMKRHKLLVVHLGGVKNHITYKARLILRNVDRPCIIICEYPVDFEDFAKIGVRTRAVM 156 Methanothermoba...
WP_011019023  80 EAPVQT----GATMGIEPEEIERINRHEVAVIHLGNVKQHIVWKARLILKHCDVPAVIVCQTPVDFEDFAEVGCRTRIVE 155 Methanopyrus ka...
WP_011033191  82 SGMRTGS------FVLSPVEVAQIEMHKLAVIHLGNIKDHVIRKTREILSQVDIPAIIVSQIPVDFEDFAEAGIKTRLVM 155 Methanosarcina ...
WP_011449110 164 PTEEnvRTKGTVMAIVSGVTRGQTPSREKISEVIHEVMKLM 204 Methanospirillum hungatei
WP_010870358 159 PLEP--KTKGTVVDIVTGVIRGESCPQTKIDEVIRKIKLHL 197 Methanocaldococcus jannaschii
WP_011171501 159 PLES--KTEGKIVEIITGVIRGESAPQKKIDEIIESIKKHL 197 Methanococcus maripaludis
WP_011405909 160 PEKS--ETQGTIVELITDVIRGESCTQEKLDEIINKVETSI 198 Methanosphaera stadtmanae
WP_010876790 157 PDEP--KTKGTIVDIVSGVIRGETCPQEKLDEIIRKVKLAL 195 Methanothermobacter thermautotrophicus
WP_011019023 156 PPEP--ETVGEVVEIVTGVIRGETVPSDKINEIVRKVrral 194 Methanopyrus kandleri
WP_011033191 156 PRDEniRTKGIVMDMVSGVTRGDSCPRDKLNLIVKYVKTTL 196 Methanosarcina mazei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap