1MRO,1E6Y


Conserved Protein Domain Family
met_CoM_red_gam

?
TIGR03259: met_CoM_red_gam 
Click on image for an interactive view with Cn3D
methyl-coenzyme M reductase, gamma subunit
Members of this protein family are the gamma subunit of methyl coenzyme M reductase, also called coenzyme-B sulfoethylthiotransferase (EC 2.8.4.1). This enzyme, with alpha, beta, and gamma subunits, catalyzes the last step in methanogenesis. Several methanogens have encode two such enzymes, designated I and II; this model does not separate the isozymes. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132303
View PSSM: TIGR03259
Aligned: 6 rows
Threshold Bit Score: 428.139
Threshold Setting Gi: 11514435
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1MRO_C   2 QYYPGTTKVAQNRRNFCNPEYELEKLREISDEDVVKILGHRAPGEEYPSVHPPLEEMDEPEDAIREMVEPIDGAKAGDRV 81  Methanothermobacter m...
P21112   6 QYTPGETQIAENRRKHMDPDYEFRKLREVSDEDLVKVLGHRNPGESYKSVHPPLDEMDFEEDIVRDMVEPIQGAKEGVRV 85  Methanothermobacter t...
O27233   3 QYYPGTSKVAQNRRNFCNPEYELEKLREISDEDVVKILGHRAPGEEYPSVHPPLEEMDEPEDAIREMVEPIDGAKAGDRV 82  Methanothermobacter t...
P07964   6 QYYPGATSVAANRRKHMSG--KLEKLREISDEDLTAVLGHRAPGSDYPSTHPPLAEMGEPACSTRENVAATPGAAAGDRV 83  Methanosarcina barker...
P11563   6 QFYPSATKVAENRRNHINPAFELEKLREIPDEDVVKIMGHRQPSEDYKTVHPPLEEMDLAEDYVRDLVGPINGAKEGHRI 85  Methanococcus voltae
1E6Y_C   5 QYYPGATSVAANRRKHMSG--KLEKLREISDEDLTAVLGHRAPGSDYPSTHPPLAEMGEPAXSTRENVAATPGAAAGDRV 82  Methanosarcina barkeri
1MRO_C  82 RYIQFTDSMYFAPAQPYVRSRAYLCRYRGADAGTLSGRQIIETRERDLEKISK-ELLETEFFDPARSGVRGKSVHGHSLR 160 Methanothermobacter m...
P21112  86 RYIQFADSMYNAPAQPYDRARTYMWRYRGVDTGTLSGRQVIEMRELDLEGVSK-ELVETELFDPATTGIRGATVHGHSLR 164 Methanothermobacter t...
O27233  83 RYIQFTDSMYFAPAQPYVRSRAYLCRYRGADAGTLSGRQIIETRERDLEKISK-ELLETEFFDPARSGVRGKSVHGHSLR 161 Methanothermobacter t...
P07964  84 RYIQFADSMYNAPATPYFRSYFAAINFRGVDPGTLSGRQIVEARERDMEQCAK-VQMETEITDHALAGVRGATVHGHSVR 162 Methanosarcina barker...
P11563  86 RYIQFADSMYFAPSQPYDRSRLYMSRFRGVDCGTLSGRQVVELRESNLEDISKnYLVDTELFDPATTGMRGATVHGHSLR 165 Methanococcus voltae
1E6Y_C  83 RYIQFADSMYNAPATPYFRSYFAAINFRGVDPGTLSGRQIVEARERDMEQCAK-VQMETEITDHALAGVRGATVHGHSVR 161 Methanosarcina barkeri
1MRO_C 161 LDEDGMMFDMLRRQIYNKDTGRVEMVKNQIGDELDEPVDLGEPLDEETLMEKTTIYRVDGEAYRDDVEAVEIMQRIHVLR 240 Methanothermobacter m...
P21112 165 LDENGLMFDALQRYVFDEEKGHVVYVKDQVGRPLDEPVDMGQPLGEDELKKITTIYRKDNIAMRDDKEAIEVVENIHTGR 244 Methanothermobacter t...
O27233 162 LDEDGMMFDMLRRQIYNKDTGRVEMVKNQIGDELDEPVDLGEPLDEETLMNKTTIYRVDGEAYRDDTDAVEIMQRIHVLR 241 Methanothermobacter t...
P07964 163 LQEDGVMFDMLDRRRL--ENGTIIMDKDQVAIPLDRKVDLGKPMSSEEAAKRTTIYRVDNVAFRDDAEVVEWVHRIFDQR 240 Methanosarcina barker...
P11563 166 LDENGVMFDALQRYEFDEATGHILYVKDQVGRPWDEPVDVGEPVPQEKLKEITTIYRKDGVAMRDDMEVVEVVKRIHRAR 245 Methanococcus voltae
1E6Y_C 162 LQEDGVMFDMLDRRRL--ENGTIIMDKDQVAIPLDRKVDLGKPMSSEEAAKRTTIYRVDNVAFRDDAEVVEWVHRIFDQR 239 Methanosarcina barkeri
1MRO_C 241 SQGGF 245 Methanothermobacter marburgensis str. Marburg
P21112 245 TMGGF 249 Methanothermobacter thermautotrophicus str. Delta H
O27233 242 SQGGY 246 Methanothermobacter thermautotrophicus str. Delta H
P07964 241 TKFGF 245 Methanosarcina barkeri str. Fusaro
P11563 246 TLGGY 250 Methanococcus voltae
1E6Y_C 240 TKFGF 244 Methanosarcina barkeri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap