Conserved Protein Domain Family
PhnT

?
TIGR03258: PhnT 
2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT
This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.
Statistics
?
PSSM-Id: 132302
View PSSM: TIGR03258
Aligned: 2 rows
Threshold Bit Score: 584.65
Threshold Setting Gi: 490686766
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_000928801  14 QGTSGIVLDSLRVAYHGNVVLKPLSLTIEPGEVLALIGPSGSGKTTVLRAVAGFVQPAG--GRILIGDTDVTHLPPYKRG 91  Salmonella ente...
WP_004551318  24 GACGGVRIEHLSVRYGARTVLDDLSLEIGAGELLAVLGKSGCGKTTLLRFIAGFVKADGltGTLAVAGRDLTHAPPHKRN 103 Burkholderia ps...
WP_000928801  92 LAMVVQNYALFPHLKVEDNVAFGLRAQKQPKALINERVTQALKTVGMSDYAARYPHQLSGGQQQRVAIARAIAVRPRVLL 171 Salmonella ente...
WP_004551318 104 LGLLFQNYALFPHLTVFENVAFGLRARRMSSADIARRVADALKLVQLGDAGHHLPAQLSGGMQQRIALARALVIEPDVLL 183 Burkholderia ps...
WP_000928801 172 LDEPLSALDAQIRHNMVEEIARLHRELPELTILYVTHDQTEALTLADKIGIMKDGSLIAHGETRALYQHPPNRFAAEFLG 251 Salmonella ente...
WP_004551318 184 LDEPLSALDANLRASVRSELKALHERLPNLTVVCVTHDRDDALVLADRALLMREGRVAQLGTPQQLYDAPADGFVARYLG 263 Burkholderia ps...
WP_000928801 252 RANILSAIalgiteapglvdvscggaVIRAFSRGSHHGYNKLLCIRPQHLSLtpRSAYSNRFNATLQSVHWQGDLTHLLC 331 Salmonella ente...
WP_004551318 264 AANLLPPN------------------VVFAFGDPRHDVRDKVACVRPERLAV--RPLGEGRLHGTIASVEWHGAALSLTV 323 Burkholderia ps...
WP_000928801 332 DV-AGETVRMV---LTHVNPLPRVGDKLALWFEPDDAVLIEV 369 Salmonella enterica
WP_004551318 324 MLdAACDEPVLvtmQRGRGPAPERGARVSLDCEADDVVLISP 365 Burkholderia pseudomallei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap