1E6Y


Conserved Protein Domain Family
met_CoM_red_bet

?
TIGR03257: met_CoM_red_bet 
Click on image for an interactive view with Cn3D
methyl-coenzyme M reductase, beta subunit
Members of this protein family are the beta subunit of methyl coenzyme M reductase, also called coenzyme-B sulfoethylthiotransferase (EC 2.8.4.1). This enzyme, with alpha, beta, and gamma subunits, catalyzes the last step in methanogenesis. Several methanogens have encode two such enzymes, designated I and II; this model does not separate the isozymes. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132301
View PSSM: TIGR03257
Aligned: 4 rows
Threshold Bit Score: 752.116
Threshold Setting Gi: 126864
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1E6Y_B   1 SDTVDIYDDRGKLLESNVDIMSLAPTRNAAIQSIIMDTKRSVAVNLAGIQGALASGKMGGKGRQILGRGLNYDIVGNADA 80  Methanosarcina barkeri
P11561   5 EDKICLFDAKGNQVAEDVPLEAISPLNNPTIMGMVKNIKRTVAVNLAGIEESLAKGKIGGKGCQVPGTNIELDVIGDAEA 84  Methanococcus voltae
P12972   5 EDKVDLYDDRGNLVEEQVPIEALSPLRNTAIKKIIHDIKRTVAVNLEGIENALRSAKVGGSGCHIPGRELDVDVIDNAEA 84  Methanothermus fervidus
P07955   2 SDTVDIYDDRGKLLESNVDIMSLAPTRNAAIQSIIMDTKRSVAVNLAGIQGALASGKMGGKGRQILGRGLNYDIVGNADA 81  Methanosarcina barker...
1E6Y_B  81 IAENVKKLVQVDEGDDTNVIKVKGGKSLLIQSPKSRIIAGADFMSATTVGAAAVTQTIMDMFGTDPYDAPIVKSAVWGSY 160 Methanosarcina barkeri
P11561  85 IADKVKSILQVSAGDDTEVKLINGGKQMAEQVPSKRLDVAAEYSVSMLSTGMALKEALITNFNIDMFDGSTVHSAIMGQY 164 Methanococcus voltae
P12972  85 IAEKAKEMIQVEEGDDTVVELLHDGKRALVKVPSSRLESAAEYSVAPLVTASAFIQSIIDVCDISIYDANMVKAAVLGRY 164 Methanothermus fervidus
P07955  82 IAENVKKLVQVDEGDDTNVIKVKGGKSLLIQSPKSRIIAGADFMSATTVGAAAVTQTIMDMFGTDPYDAPIVKSAVWGSY 161 Methanosarcina barker...
1E6Y_B 161 PQTMDLMGGQVQGILSIPQNNEGLGFSLRNIMANHVAAISNRNAMNASALSSIYEQSGIFEMGGAVGMFERHQLLGLAYQ 240 Methanosarcina barkeri
P11561 165 PQDMDYAGGNIASLLGAPSKLEGLGYALRNIPVNHAVATTKKSLMNAIAFSSILEQTAMFEMGDAVGSFERQHLLGLAYQ 244 Methanococcus voltae
P12972 165 PQSVEYVGGNIATMLDIPQKLEGPGYALRNILVNHIVAATLKNTLQAVALSSILEHTAMFEMGDAVGKFERLHLLGLAYQ 244 Methanothermus fervidus
P07955 162 PQTMDLMGGQVQGILSIPQNNEGLGFSLRNIMANHVAAISNRNAMNASALSSIYEQSGIFEMGGAVGMFERHQLLGLAYQ 241 Methanosarcina barker...
1E6Y_B 241 GLNANNLLYDIVKENGKdGTIGTVIESVVRRAIEAGIISVDKTAPSGYNFYKANDVPKWNACAAVGTLAATLVNCGAGRA 320 Methanosarcina barkeri
P11561 245 GLNADNLVVELVKANAT-GTVGSVVNSIVEKAIADGVIVVDKTLGSGFNMYKPADVNKWNAYAAAGLVAAVMVSCGAARA 323 Methanococcus voltae
P12972 245 GLNADNLLYDLVKANGKdGTVGSVVEDVVERAKEDGVIKV-EKELNGYKVYGTDDLALWNAYAAAGLVAATIVNQGAARA 323 Methanothermus fervidus
P07955 242 GLNANNLLYDIVKENGKdGTIGTVIESVVRRAIEAGIISVDKTAPSGYNFYKANDVPKWNACAAVGTLAATLVNCGAGRA 321 Methanosarcina barker...
1E6Y_B 321 AQNVSSTLLYFNDILEKETGLPGCDYGKVEGTAVGFSFFSHSIYGGGGPGVFNGNHVVTRHSRGFAIPCVCAAVALDAGT 400 Methanosarcina barkeri
P11561 324 AQNVASTILYYNDILEYETGLPGVDYGRSMGTAVGFSFFSHSIYGGGGPGIFNGNHVVTRHSKGFAIPPVCAAMCMDAGT 403 Methanococcus voltae
P12972 324 AQGVSSTILYDNDIIEFERGLPGVDFGRAEGTAVGFSFFSHSIYGGGGPGIFNGNHIVTRHSKGFAIPCVAAAMALDAGT 403 Methanothermus fervidus
P07955 322 AQNVSSTLLYFNDILEKETGLPGCDYGKVEGTAVGFSFFSHSIYGGGGPGVFNGNHVVTRHSRGFAIPCVCAAVALDAGT 401 Methanosarcina barker...
1E6Y_B 401 QMFSIESTSGLIGDVFGAIPEFREPIKAVAGVL 433 Methanosarcina barkeri
P11561 404 QMFSPEKTSALVGTVYSAFDEFREPLKYVIEGA 436 Methanococcus voltae
P12972 404 QMFSPELTSGLIKDVFSKVDEFREPLKYVVELQ 436 Methanothermus fervidus
P07955 402 QMFSIESTSGLIGDVFGAIPEFREPIKAVAGVL 434 Methanosarcina barkeri str. Fusaro
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap