3POT,1E6Y


Conserved Protein Domain Family
met_CoM_red_alp

?
TIGR03256: met_CoM_red_alp 
Click on image for an interactive view with Cn3D
methyl-coenzyme M reductase, alpha subunit
Members of this protein family are the alpha subunit of methyl coenzyme M reductase, also called coenzyme-B sulfoethylthiotransferase (EC 2.8.4.1). This enzyme, with alpha, beta, and gamma subunits, catalyzes the last step in methanogenesis. Several methanogens have encode two such enzymes, designated I and II; this model does not separate the isozymes. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132300
View PSSM: TIGR03256
Aligned: 6 rows
Threshold Bit Score: 1034.86
Threshold Setting Gi: 12084789
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3POT_A   3 DKlFINALKKKFE-ESPEEK--------KTTFYTLGGWKQSERKTEFVNAGKEVAAKRGIPQYNPDI--GTPLGQRVLMP 71  Methanothermobacter m...
P07962   7 SK-FKKDMEVKFAqEFGSNKqtggditdKTAKFLRLGPEQDPRKVEMIKAGKEIAEKRGIAFYNPMMhsGAPLGQRAITP 85  Methanosarcina barker...
Q49605   6 EKlFMKALKEKFE-ESPEEK--------YTKFYIFGGWKQSERKKEFKEWADKIVEERGVPHYNPDI--GVPLGQRKLMS 74  Methanopyrus kandleri...
O27232   3 DKlFINALKKKFE-ESPEEK--------KTTFYTLGGWKQSERKTEFVNAGKEVAAKRGIPQYNPDI--GTPLGQRVLMP 71  Methanothermobacter t...
P12971   6 KKlFVDALRKKFK-EEPKER--------KTTFYTLGGWKQSERKKEFVEYGKKVAKERGIPAYNPDI--GTPLGQRVLMP 74  Methanothermus fervidus
1E6Y_A   5 fskFKKDMEVKFAqEFGSNKqtggditdKTAKFLRLGPEQDPRKVEMIKAGKEIAEKRGIAFYNPMMhsGAPLGQRAITP 84  Methanosarcina barkeri
3POT_A  72 YQVSTTDTYVEGDDLHFVNNAAMQQMWDDIRRTVIVGLNHAHAVIEKRLGKEVTPETITHYLETVNHAMPGAAVVQEHMV 151 Methanothermobacter m...
P07962  86 YTISGTDIVCEPDDLHYVNNAAMQQMWDDIRRTCIVGLDMAHETLEKRLGKEVTPETINHYLEVLNHAMPGAAVVQEMMV 165 Methanosarcina barker...
Q49605  75 YQVSGTDVFVEGDDLHFVNNAAMQQMWDDIRRTVIVGMDTAHRVLERRLGKEVTPETINEYMETLNHALPGGAVVQEHMV 154 Methanopyrus kandleri...
O27232  72 YQVSTTDTFVEGDDLHFVNNAAMQQMWDDIRRTVIVGLNHAHAVIEKRLGKEVTPETITHYLETVNHAMPGAAVVQEHMV 151 Methanothermobacter t...
P12971  75 YQVSTTDTFVEGDDLHFVNNLAMQQFWDDIRRTVIVGLNHAHRILERSLGKEVTPETINHYLETVNHAMPGAAVVQEHMV 154 Methanothermus fervidus
1E6Y_A  85 YTISGTDIVCEPDDLHYVNNAAMQQMWDDIRRTCIVGLDMAHETLEKRLGKEVTPETINHYLEVLNHAMPGAAVVQEMMV 164 Methanosarcina barkeri
3POT_A 152 ETHPALVADSYVKVFTGNDEIADEIDPAFVIDINKQFPEDQAETLKAEVGDGIWQVVRIPTIVSRTCDGATTSRWSAMQI 231 Methanothermobacter m...
P07962 166 ETHPALVDDCYVKVFTGDDALADEIDKQFLIDINKEFSEEQAAQIKASIGKTSWQAIHIPTIVSRTTDGAQTSRWAAMQI 245 Methanosarcina barker...
Q49605 155 EIHPGLTWDCYAKIITGDLELADEIDDKFLIDIEKLFPEEQAEQLIKAIGNRTYQVCRMPTIVGHVCDGATMYRWAAMQI 234 Methanopyrus kandleri...
O27232 152 ETHPALVADSYVKVFTGNDEIADEIDPAFVIDINKQFPEDQAETLKAEVGDGIWQVVRIPTIVSRTCDGATTSRWSAMQI 231 Methanothermobacter t...
P12971 155 ETHPGLTADSYVKVFTGNDELADEIESCYLIDINKQFPEHQAEQLKKAIGHTIWQAVRIPTIVSRTCDGATTSRWSAMQI 234 Methanothermus fervidus
1E6Y_A 165 ETHPALVDDCYVKVFTGDDALADEIDKQFLIDINKEFSEEQAAQIKASIGKTSWQAIHIPTIVSRTTDGAQTSRWAAMQI 244 Methanosarcina barkeri
3POT_A 232 GMSMISAYKQAAGEAATGDFAYAAKXAEVIHMGTYLPVRXARGENEPGGVPFGYLADICQSSRvNYEDPVRVSLDVVATG 311 Methanothermobacter m...
P07962 246 GMSFISAYAMCAGEAAVADLSFAAKHAALVSMGEMLPARRARGPNEPGGLSFGHLSDIVQTSR-VSEDPAKIALEVVGAG 324 Methanosarcina barker...
Q49605 235 AMSFICAYKIAAGEAAVSDFAFASKHAEVINMGEMLPARRARGENEPGGVPFGVLADCVQTMRkYPDDPAKVALEVIAAG 314 Methanopyrus kandleri...
O27232 232 GMSMISAYKQAAGEAATGDFAYAAKHAEVIHMGTYLPVRRARGENEPGGVPFGYLADICQSSRvNYEDPVRVSLDVVATG 311 Methanothermobacter t...
P12971 235 GMSMISAYKQAAGEAATADFAYAAKHAEVIHLGTFLPVRRARGENELGGVPFGFLADIVQSSRvHYEDPVRVALDVVASG 314 Methanothermus fervidus
1E6Y_A 245 GMSFISAYAMCAGEAAVADLSFAAKXAALVSMGEMLPARXARGPNEPGGLSFGHLSDIVQTSRv-SEDPAKIALEVVGAG 323 Methanosarcina barkeri
3POT_A 312 AMLYDQIWLGSYMSGGVGFTQYATAAYTDNILDDFTYFGKEYVEDKYG-LCE------A------PNNMDTVLDVATEVT 378 Methanothermobacter m...
P07962 325 CMLYDQIWLGSYMSGGVGFTQYATAAYTDDILDNNTYYDVDYINDKYNgAAT------VgkdnkvKASLEVVKDIATEST 398 Methanosarcina barker...
Q49605 315 AMLYDQIWLGSYMSGGVGFTQYATAVYTDNILDDYVYYGLEYVEDKYG-IAE------A------EPSMDVVKDVATEVT 381 Methanopyrus kandleri...
O27232 312 AMLYDQIWLGSYMSGGVGFTQYATAAYTDNILDDFTYFGKEYVEDKYG-LCE------A------PNTMDTVLDVASEVT 378 Methanothermobacter t...
P12971 315 AMLYDQIWLGSYMSGGVGFTQYATASYTDNILDDFTYYGKEYVEDKYGgLAE------A------PHDFDTILDVATEVT 382 Methanothermus fervidus
1E6Y_A 324 CMLYDQIWLGSYMSGGVGFTQYATAAYTDDILDNNTYYDVDYINDKYNgAATvgkdnkV------KASLEVVKDIATEST 397 Methanosarcina barkeri
3POT_A 379 FYGLEQYEEYPALLEDQFGGSXRAAVVAAAAGCSTAFATGNAQTGLSGWYLSMYLHKEQHSRLGFYXYDLQDQXGASNVF 458 Methanothermobacter m...
P07962 399 LYGIETYEKFPTALEDHFGGSQRATVLAAAAGVACSLATGNANAGLSGWYLSMYLHKEAWGRLGFFGFDLQDQCGATNVL 478 Methanosarcina barker...
Q49605 382 LYGLEQYERYPAAMETHFGGSQRAAVCAAAAGCSTAFATGHAQAGLNGWYLSQILHKEGHGRLGFYGYALQDQCGAANSL 461 Methanopyrus kandleri...
O27232 379 FYGLEQYEEYPALLEDQFGGSQRAAVVAAAAGCSTAFATANAQTGLSGWYLSMYLHKEQHSRLGFYGYDLQDQCGASNVF 458 Methanothermobacter t...
P12971 383 LYSLDQYEEYPTLMEDHFGGSQRAAIAAAASGCSTAFAAGNAQAGLSGWYLSQILHKECHARLGFYGYDLQDQCGAANTY 462 Methanothermus fervidus
1E6Y_A 398 LYGIETYEKFPTALEDHFGGSQRATVLAAAAGVACSLATGNANAGLSGWYLSMYLHKEAWGRLGFFXFDLQDQXGATNVL 477 Methanosarcina barkeri
3POT_A 459 SIRGDEGLPLELRGPNYPNYAMNVGHQGEYAGISQAPHAARGDAFVFNPLVKIAFADDNLVFDFTNVRGEFAKGALREFE 538 Methanothermobacter m...
P07962 479 SYQGDEGLPDELRGPNYPNYAMNVGHQGGYAGIAQAAHSGRGDAFTVNPLLKVCFADDLLPFNFAEPRREFGRGAIREFV 558 Methanosarcina barker...
Q49605 462 SVRSDEGLPLELRGPNYPNYAMNVGHLGEYAGIVQAAHAARGDAFCVHPVIKVAFADENLVFDFTEPRKEFAKGALREFE 541 Methanopyrus kandleri...
O27232 459 SIRGDEGLPLELRGPNYPNYAMNVGHQGEYAGISQAPHAARGDAFVFNPLVKIAFADDNLVFDFTNVRGEFAKGALREFE 538 Methanothermobacter t...
P12971 463 SIRSDEGLPAELRGPNYPNYAMNVGHLGEYAGIVQAAHIARGDADSLNPLVKVAFADDNLPFDWTNPRGEFAKGALREFE 542 Methanothermus fervidus
1E6Y_A 478 SYQGDEGLPDELRGPNYPNYAMNVGHQGGYAGIAQAAHSGRGDAFTVNPLLKVCFADDLLPFNFAEPRREFGRGAIREFV 557 Methanosarcina barkeri
3POT_A 539 PAGERALITPA 549 Methanothermobacter marburgensis
P07962 559 PAGERSLVIPA 569 Methanosarcina barkeri str. Fusaro
Q49605 542 PAGERDLIVPA 552 Methanopyrus kandleri AV19
O27232 539 PAGERALITPA 549 Methanothermobacter thermautotrophicus str. Delta H
P12971 543 PEGERDLIRPA 553 Methanothermus fervidus
1E6Y_A 558 PAGERSLVIPA 568 Methanosarcina barkeri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap