Conserved Protein Domain Family
PhnV

?
TIGR03255: PhnV 
2-aminoethylphosphonate ABC transport system, membrane component PhnV
This membrane component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.
Statistics
?
PSSM-Id: 132299
View PSSM: TIGR03255
Aligned: 2 rows
Threshold Bit Score: 297.292
Threshold Setting Gi: 500178263
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011852688  17 LRWTDAasrvaSRALVA-LAAAaCCWLFVLPVVVVALSSVAGHWSGtILPAGYSLRWF-ERLGRPEFDALAASLEIGLGV 94  Burkholderia ps...
WP_000909791   2 LIWSPK-----GRAAAGvVASVlFIVFFFLPLAVILMSSLSQQWNG-ILPSGFTLNHFvNALHGAAWDALLASLTIGFCA 75  Salmonella ente...
WP_011852688  95 AALGTA--LGVALALALEGRTRRgvgALVDALVMLPNGVPSVVLGLAVLIAYHAKPVDLSSSPAIVVFVQLALVLPFCYR 172 Burkholderia ps...
WP_000909791  76 SLFALLcgVWAALALRQYGVKTQ---KWLSMVFYLPSAIPSVSVGLGILVAFSQGPLQMNGTLWIVLTAHFVLISAFTFS 152 Salmonella ente...
WP_011852688 173 CAAAALRPELTVLREAAASLGAPPAMVLRRVLLPQLVPAIRASLALGFALSLGELGATLTVYPPGFATVPIVVIGAVERG 252 Burkholderia ps...
WP_000909791 153 NVSTGLARISADIENVASSLGASPWYRLRHVTLPLLMPWMMSALALSLSLSMGELGATMMIYPPGWTTLPVAIFSLTDRG 232 Salmonella ente...
WP_011852688 253 YYLPASALSLLLLGASLVALIAIAARAPRPPR 284 Burkholderia pseudomallei
WP_000909791 233 NIADGAALTIVLVAITLLLMMKLERIAKRLGQ 264 Salmonella enterica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap