Conserved Protein Domain Family
TIGR03252

?
TIGR03252: TIGR03252 
uncharacterized HhH-GPD family protein
This model describes a small, well-conserved bacterial protein family. Its sequence largely consists of a domain, HhH-GPD, found in a variety of related base excision DNA repair enzymes (see pfam00730). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 132296
View PSSM: TIGR03252
Aligned: 5 rows
Threshold Bit Score: 306.351
Threshold Setting Gi: 499756199
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003974916   4 TLHLAQDPEADELLGRSPLAALVGMLLDQQVPMEWAFKGPSTIARRMGAedLDAHDIAAYDPESFAALLSDKPAVHRYPG 83  Streptomyces
WP_003406064   3 NLQLVQEPAADALLNANPFALLVGMLLDQQVPMETAFAGPKKIADRMGS--FDAGDIADYDPDKFVALCSERPAIHRFPG 80  Mycobacterium t...
WP_011690120   2 ELHITGDPAADKLLSDDAFALLTGMLLDQQVTMESAFAGPEKIRTRIGS--MDPAAIAGYNPQDFVEMFKERPAVHRFPG 79  Arthrobacter sp...
WP_011206808   4 TLCLAQEPEADKLLSEDPFALLTGMLLDQQYPLEHAFRGPRKIAERMDG--FDIRRIAEADPQEFEELCATPPAIHRYGR 81  Nocardia farcinica
WP_011436933  34 GLHLSQIAEADELLTSDPLALLIGMVLDQQIPLERAFAAPHELTRRLGQp-LDAEELAKYDPDALGAIFSQVPALHRFPG 112 Frankia sp. CcI3
WP_003974916  84 SMAGRVQQLCRYLVETYDGDAEAVWR-GVSTGKELLKRLQELPGFGKQKAQIFLALLGKQLGVRPEGWREAAGAYGEADS 162 Streptomyces
WP_003406064  81 SMAKRIQALAQIIVDRYDGDAAALWTaGEPDGNELLRRLKGLPGFGEQKARIFLALLGKQYGVTPKGWQVAAGEFGQPGT 160 Mycobacterium t...
WP_011690120  80 SMAGRVQALAETVHQDWNGDATAIWTqGDPDGPEVLRRLKALPGFGEQKAKIFLALLGKQCGLQAEGWREAAGHYGQQDS 159 Arthrobacter sp...
WP_011206808  82 SMARRTQDLARYVLEHYDGDTTRIWSeGDPDGATVLRRLEDLPGYGKQKARIFLALLGKQLGVRPKGWEKAAGDYAEPNS 161 Nocardia farcinica
WP_011436933 113 SMAKRVQAMCQLIVDTYDGDAARVWT-TAADGKELLRRVAALPGFGQQKAKIFVALLGKQLGVTPPGWREASAPFGDEGT 191 Frankia sp. CcI3
WP_003974916 163 FRSVADIRGPESLTKVRAH 181 Streptomyces
WP_003406064 161 YLSVADIVDAGSLGQVRSH 179 Mycobacterium tuberculosis complex
WP_011690120 160 YLSVADIVDPESLTKVRas 178 Arthrobacter sp. FB24
WP_011206808 162 RRSAADITDGQSLLEVRAF 180 Nocardia farcinica
WP_011436933 192 FRSIADITDVATRDQVREY 210 Frankia sp. CcI3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap