4I3T


Conserved Protein Domain Family
PhnAcAld_DH

?
TIGR03250: PhnAcAld_DH 
Click on image for an interactive view with Cn3D
putative phosphonoacetaldehyde dehydrogenase
This family of genes are members of the pfam00171 NAD-dependent aldehyde dehydrogenase family. These genes are observed in Ralstonia eutropha JMP134, Sinorhizobium meliloti 1021, Burkholderia mallei ATCC 23344, Burkholderia thailandensis E264, Burkholderia cenocepacia AU 1054, Burkholderia pseudomallei K96243 and 1710b, Burkholderia xenovorans LB400, Burkholderia sp. 383 and Polaromonas sp. JS666 in close proximity to the PhnW gene (TIGR02326) encoding 2-aminoethyl phosphonate aminotransferase (which generates phosphonoacetaldehyde) and PhnA (TIGR02335) encoding phosphonoacetate hydrolase (not to be confused with the alkylphosphonate utilization operon protein PhnA modeled by TIGR00686). Additionally, transporters believed to be specific for 2-aminoethyl phosphonate are often present. PhnW is, in other organisms, coupled with PhnX (TIGR01422) for the degradation of phosphonoacetaldehyde (GenProp0238), but PhnX is apparently absent in each of the organisms containing this aldehyde reductase. PhnA, characterized in a strain of Pseudomonas fluorescens that has not het been genome sequenced, is only rarely found outside of the PhnW and aldehyde dehydrogenase context. For instance in Rhodopseudomonas and Bordetella bronchiseptica, where it is adjacent to transporters presumably specific for the import of phosphonoacetate. It seems reasonably certain then, that this enzyme catalyzes the NAD-dependent oxidation of phosphonoacetaldehyde to phosphonoacetate, bridging the metabolic gap between PhnW and PhnA. We propose the name phosphonoacetaldehyde dehydrogenase and the gene symbol PhnY for this enzyme.
Statistics
?
PSSM-Id: 132294
View PSSM: TIGR03250
Aligned: 6 rows
Threshold Bit Score: 853.736
Threshold Setting Gi: 560188813
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4I3T_A        13 VRHEPMRIAGRLVDTDDRVEVRYPWNDTVVGTVPAGRAEHAREAFAIAAAYQPKLTRYERQKILLATAEALAARKEEISD 92  Sinorhizobium m...
WP_011353587  13 IRREALRIDGERIHRDAVIEVRNPYDGSLVGTVPKATLDDVRRAFAVARAYRPTLTRHDRSAILRRAADIVRARTAEIAG 92  Burkholderia lata
WP_011301982   9 IRHEALRIAGEKVYRDRVIEVTYPYTGEVIATVPKANIEDVRRALRIAHQYRSTLTRYERYRILMRAGEIIAKRKEEIAT 88  Cupriavidus pin...
WP_011353967  12 FRAEALRWCGTRATRERTLDVMDPYTGTRVGTAPLASVDDVRAAFDYAMAYRPKLTRYERSQILERAAALLRERTEEASD 91  Burkholderia lata
KGC34097      11 RVARALDARG-KTSSGATLVVSHPYNRETVAELPLDSGDDARRKLQRAARFRSALSRHERIAVFDKAIALLAAEKRDASI 89  Burkholderia ps...
WP_011299846  15 FRAEALRIDGQKVVRERVIEVRNPYDGTLVGTVPKATVEDVRRAYEVAHGYRSTLTRYERAAILNRAAALLRERTEEASD 94  Cupriavidus pin...
4I3T_A        93 VITLELGISKADSLYEVGRAFDVFTLAGQMCIRDDGEIFSCDLTPHGKARKIFTMREPLT-AISAITPFNHPLNMVAHKV 171 Sinorhizobium m...
WP_011353587  93 LITAESGLCVKDSTYEAGRVADVLTFGAGEVLKDDGQIFSCDLTPHGKKRRVYTQRDPLLgVISAITPFNHPMNQVAHKI 172 Burkholderia lata
WP_011301982  89 LITLESGLSLKDTLYEVGRASDVLLFAANQALVDDGQVFSCDLTPHGKSRKVYTLKEPLLgAISAITPFNHPLNQVIHKV 168 Cupriavidus pin...
WP_011353967  92 LITLESGLSKQDSRYEIGRVADVLKFAAIEALRDDAQSFSCDLTPHGKARRVFSQRQPLDgVIVAITPFNHPMNQVAHKI 171 Burkholderia lata
KGC34097      90 LITLESGLCRKDTMYEVDRVINVLHAAIAELNRDDGQTFSCDNATSDERRKIFTVREPLRgVIVAITPFNHPMNQVAHKI 169 Burkholderia ps...
WP_011299846  95 LITLESGLSKKDSIYEIGRVADVLGFAATETLRDDGQMFSCDLTPHGKRRRVMTQREPLLgAICAITPFNHPMNQVAHKV 174 Cupriavidus pin...
4I3T_A       172 APAIATNNCVVVKPTELTPMTALLLADILYEAGLPPEMLSVVTGWPADIGMEMITNPHVDLVTFTGSVPVGKLIAANAHY 251 Sinorhizobium m...
WP_011353587 173 VPSVATNNRMVVKPSEKVPLSCYLFADILYEAGLPPQMLQVLTGDPKEIADELITNPAIDLITFTGGVSIGKSIASRMGY 252 Burkholderia lata
WP_011301982 169 APAVATNNRMVLKPSEKTPLAAFALADILYEAGLPPQMLSVVTGDPREIADELLTSQYVDLVTFTGGVSIGKYIAAKAAY 248 Cupriavidus pin...
WP_011353967 172 APAIATNNRVIVKPSEKVPLSAFYLADLLYEAGLPEPMLQVLTGDPREIADELVTHPHASLITFTGGVAIGKAIAARAGY 251 Burkholderia lata
KGC34097     170 CPAIASNNRIVLKPSEKTPLSALYLLDLFREAGLPEPMFDVVIGEPNALGAALVCDEHVELVAFTGSVAVGKRIAQMAGY 249 Burkholderia ps...
WP_011299846 175 APSIATNNRMVLKPSEKVPLSAYYLADLLYESGLPPQMLQVITGDPREIADELITHPLVDLITFTGGVAIGKYIANKAGY 254 Cupriavidus pin...
4I3T_A       252 KRQVLELGGNDPLIILNdlsDDDLARAADLAVAGATKNSGQRCTAVKRILCQESVADRFVPLVLERAKRLRFGDPMDRST 331 Sinorhizobium m...
WP_011353587 253 RRAVLELGGNDPIIVME---DADLDEASTLAVSGSYKNSGQRCTAIKRMLVHESVADRFTELVVEKTRAWSYGNPADPSV 329 Burkholderia lata
WP_011301982 249 KRQVLELGGNDPIIVME---DADLEEAATLAAGGSYKNSGQRCTAVKRMLVQESVADRFVELLVAKTQEVKYGDPLDPAT 325 Cupriavidus pin...
WP_011353967 252 RRIVLELGGNDPLIVLD---DADLDRATSLAVLGSYRNSGQRCTAVKRMLVQRSIAPAFTELLVEKTRAWKYGDPFDPAN 328 Burkholderia lata
KGC34097     250 RRTVLELGGNDPLIVME---DADLERAAQLAAKGSYKNSGQRCTAVKRILVERTVARPFTELLVEHSRRWQTGDPMDERV 326 Burkholderia ps...
WP_011299846 255 KRVVLELGGNDPLIVLD---DADLDRASDLAVQGSYKNSGQRCTAVKRMLVHEAVAARFTELVVEKTRAWRYGNPMDRSV 331 Cupriavidus pin...
4I3T_A       332 DLGTVIHEKAAALFEERVMRAAEEGADILYHPGRSGALLPPIVVDRVPHQSDLVLEETFGPIIPIVRVPDDDDAtITLSN 411 Sinorhizobium m...
WP_011353587 330 DMGTVIDEAAAKFCEQQVNDAIARGARLLVGNVRNGALYSPTVIDRVTPDMPLVKYETFGPVSPIMRFSDIDEA-IRMSN 408 Burkholderia lata
WP_011301982 326 DMGTVIDEAAAIQFESVVNAAIAGGARLLAGHTRDGALYAPTVLDHVDPEMAVVRHETFGPVSPVIRFKDIDDA-IRISN 404 Cupriavidus pin...
WP_011353967 329 EMGTVIDEEAARLFEARVEEAVAQGARLLTGNVRRGALYAPTVLDNVDPSMTIVREETFGPVSPVITFDTIDDA-IRISN 407 Burkholderia lata
KGC34097     327 DIGTLIDDAAAIECARRVDEARDAGARVLLGHQRDGAAYAPTVLERVGPALRLVQQETFGPVSPVITFCGLDEA-VAIAN 405 Burkholderia ps...
WP_011299846 332 DMGTVIDAQAAELFEARVNEAVAQGARLLIGNKRNGASYSPTVLDRVDPSMTVVREETFGPVSPIITFRDVDDA-IRISN 410 Cupriavidus pin...
4I3T_A       412 STAFGLSSGVCTNDYRRMQKYIAGLKVGTVNIWEVPGYRIEMSPFGGIKDSGNGYKEGVIEAMKSFTNVKTFSLPW 487 Sinorhizobium melil...
WP_011353587 409 STDYALSSSVCTNRFDSITRFITELEVGSVNVREVPGYRLELTPFGGVKDSGLGYKEGVQEAMKSFTNTKTYSLPW 484 Burkholderia lata
WP_011301982 405 GTAYGLSSSVCTNRLDYITRFIRELQVGTVNVREVPGYRLEMTPFGGIKDSGLGYKEGVLEAMKSFCNTKTYSLPW 480 Cupriavidus pinatub...
WP_011353967 408 GTAFGLSSGVCTDSTAAVVRFVNELNVGTVNVWEVPGYRIELSPFGGIKDSGLGYKEGVQEAMKSFTNLKTFSLPW 483 Burkholderia lata
KGC34097     406 STRYGLSSGVCTNRLDYITHLIAHLDVGTVNVWEVPGFRLESTPFGGVKDSGLGSKEGMQEAIKNFTNLKTYSLPW 481 Burkholderia pseudo...
WP_011299846 411 GTAFGLSSGVCTNRMDDFTKIANSLQVGTVNLWEVPGYRIELTPFGGIKDSGLGYKEGVQEAVKSFTNLKTVTLPW 486 Cupriavidus pinatub...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap