Conserved Protein Domain Family
KdgD

?
TIGR03249: KdgD 
5-dehydro-4-deoxyglucarate dehydratase
5-dehydro-4-deoxyglucarate dehydratase not only catalyzes the dehydration of the substrate (diol to ketone + water), but causes the decarboxylation of the intermediate product to yield 2-oxoglutarate semialdehyde (2,5-dioxopentanoate). The gene for the enzyme is usually observed in the vicinity of transporters and dehydratases handling D-galactarate and D-gluconate as well as aldehyde dehydrogenases which convert the product to alpha-ketoglutarate.
Statistics
?
PSSM-Id: 132293
View PSSM: TIGR03249
Aligned: 7 rows
Threshold Bit Score: 498.466
Threshold Setting Gi: 499523397
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011067238   1 MNRKAPTGILGFPVTPFDNQGNIDELALSQNIKYLLDSGLEAIFVACGAGEYHSLENGEYESIIEIATSTVKGQVPVYTG 80  Oceanobacillus ...
WP_011088612   9 MAQTIGSGLLSFPVTPFKADYSFDEATYRANMDWLCGYDVAGLFAAGGTGEFFSLTPTEVPQIVKIAVEETKGRVPVLAG 88  Bradyrhizobium ...
WP_009330287  32 QLRKAPEGILGFPVAPFNREGKLEEEALYENIRFLLDEGLEAVFIACGSGEFQSLSTKEYEQMVEIAVSAADGKVPVYTG 111 Bacillus sp. BT...
WP_011245330   1 MQTNKLTGILGFPVSPFDKNGALDENALHRNITFLIEEGLEAIFVACGAGEFHAISKAEYGAILDVAVDATQKRVPLYTG 80  Bacillus clausii
WP_011425325   7 LKKAVGSGLLSFPVTHFDDQLKFDEAKYRRHVEWLAGYDAAALFAAGGTGEFFSLNPAEIPQVVRAA-KVSAGNTPIISG 85  Rhizobium etli
WP_011546881   7 LKQIISHGLLSFPLTDFDADGSFRPSTYAERLEWLAPYGASALFAAGGTGEFFSLTQREYSDVIRVATETCKGKVPILAG 86  Burkholderia ce...
WP_011210037   9 IAARLGSGLLSFPVTHLRADGSFDEAAYREHIAWLGGHDAAGLFAAGGTGEFFSLTPAEVEQVVTAAVREAPEGLPVIAP 88  Nocardia farcinica
WP_011067238  81 VGGNLSDAVHKAKLSEKHGVDGYLIMPAYLINGEQEGIYQYVHSIATSTDLNAIVYQRDNVVMNLDTIEKLVE-IPQIVG 159 Oceanobacillus ...
WP_011088612  89 TGYGTAIAREIAVGAEKAGADGLLLLPPYLTHSEQDGLAAHVEAVCAAVKIGVIVYNRDNAILQPDTLARLAErCPNLVG 168 Bradyrhizobium ...
WP_009330287 112 VGGNLSTALEWARISEEKGADGYLILPPYLIHGEQEGLYQYTKTIIESTDLNAIIYQRDNAVLTLEQIQRLTD-LEQLVG 190 Bacillus sp. BT...
WP_011245330  81 VGGNIQDALSFARLSEEKGADGYLILPPYLINGEQNGLHAYLSAIIESTSLHAIVYQRDNAVLEGDTLESLLV-YPQLVG 159 Bacillus clausii
WP_011425325  86 TGYGTSLAIEIAQAAEKAGADGLLLLPPYLMFAEQAGLIAHVKAVCQSVGIGVIVYNRDNAVLTAESIARLAEeCPNLIG 165 Rhizobium etli
WP_011546881  87 AGGATRVAIEYAQEAERLGASGVLLMPHYLTEASQEGIADHVEQVCRALKIGVVVYNRANSKLNADMLERLADrCPNLIG 166 Burkholderia ce...
WP_011210037  89 AGYGTATAIEMARAAERAGAHGILLLPPYLTEAGQRGLVEHVRQVCAATDLGVIVYSRANAAYSAPAVAELADrCPNLIG 168 Nocardia farcinica
WP_011067238 160 FKDGHGSMEHIIEFTQSIGNKIGWLNGMPMAEVTMPAYIPLGFDSYSSAISNYIPHISRKFYDALLEGDETTVNEIYQEV 239 Oceanobacillus ...
WP_011088612 169 YKDGIGDIELMTRVYTKLGDRLTYIGGLPTAETFALPYLDMGVTTYSSAVFNFVPEFATNFYAAVRKRDHATIHAGLKDF 248 Bradyrhizobium ...
WP_009330287 191 LKDGIGDMALNISLSYTIGDRLGWLNGMPMAEVTMPAYAPIGFTSYSSAISNYIPHISRMFYEALLNGNDRLVKEIYEQV 270 Bacillus sp. BT...
WP_011245330 160 LKDGIGNMEQNIEFTQRFGERLLWLNGMPMAELTMPAYWPIGFHSYSSAISNYIPHISRCFFEALKRGDHEAVRTLYKDV 239 Bacillus clausii
WP_011425325 166 FKDGVGDVDKVIEITTLLGDRLVYVGGMPTHEVYAQAYFAAGVTTYSSAVFNFVPALAQRFYGALRTGNQATVDEILKSF 245 Rhizobium etli
WP_011546881 167 FKDGVGEIESMVTIRRRLGDRFAYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAMAFYEAIAKDDHATVGRLIDEF 246 Burkholderia ce...
WP_011210037 169 FKDGIGNIEQMTRIYAEVGDRLFYVGGLPTAEMFALPYLALGVTTYSSAIFNFVPQFALDFYRAVRRNDAPFVLNALAEF 248 Nocardia farcinica
WP_011067238 240 ILPINRIRRQGKGYAISLIKAGMEIVGLPInsNNVRPPVTPVKKEHYEQLEEILKKAL 297 Oceanobacillus iheyensis
WP_011088612 249 ILPLIAIRNRKKGYAVSIIKAGMKVIGRDS--GPVRPPLTDLTEQEIAELTALVKKLP 304 Bradyrhizobium diazoefficiens
WP_009330287 271 IIPINEIRKLRKGYAVSLIKAGMEIMGLHVk-NTARPPIVPVEKEHCRQLENILKNAM 327 Bacillus sp. BT1B_CT2
WP_011245330 240 LLPINVIRRQKKGYAVSLIKAGMEIVGLPVq-EHVRAPLVPVEKSHYKQLAQILENAH 296 Bacillus clausii
WP_011425325 246 FFPFVALRNRKKGYAVSIIKAGLRVLGQNP--GPVRPPLTDLTQEELALLEKIVQANG 301 Rhizobium etli
WP_011546881 247 FLPYLKIRNRRAGYAVSIVKAGAKLVGHDA--GPVRAPLVDLTDEEAAELDVLIKKMG 302 Burkholderia cenocepacia
WP_011210037 249 VIPYCELRNREPGYAVSIIKAGMTVIGRPA--GPVRSPLTDLDDAELAELADLVKKVS 304 Nocardia farcinica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap