1YW6


Conserved Protein Domain Family
arg_catab_astE

?
TIGR03242: arg_catab_astE 
Click on image for an interactive view with Cn3D
succinylglutamate desuccinylase
Members of this protein family are succinylglutamate desuccinylase, the fifth and final enzyme of the arginine succinyltransferase (AST) pathway for arginine catabolism. This model excludes the related protein aspartoacylase. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 132286
View PSSM: TIGR03242
Aligned: 8 rows
Threshold Bit Score: 471.851
Threshold Setting Gi: 499257633
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YW6_A         8 NFLALTLTGKKP-VITERE--INGVRWR-----WLGDGVLELTPL-----------TPPQGALVISAGIHGNETAPVEXL 68  Escherichia coli
WP_011055562   4 DFLAITLSGKPP-QVIQGE--TVNLKWQ-----WLGEGILTLVPH-----------RSYTQSVVISAGIHGNETAPIEIL 64  Yersinia
WP_000368529   3 NFLALTLTSKKP-VITERE--INGVRWR-----WLGDGVLELTPL-----------TPPQGALVISAGIHGNETAPVEML 63  Escherichia coli
WP_004925864   3 HFLHSVLSQQFP-HALQGE--NHNFSWQ-----WQDEGVICLTPH-----------HGYEKSIVLSAGIHGNETAPIELL 63  Acinetobacter
WP_004191679  16 DFLALTLAGDAP-PAEAGEcaARAVRWR-----WLGDGLLRLEPAd---------aAQRMQSVLVSAGVHGDETAPIELL 80  Burkholderia ma...
WP_011147322   2 dlltlllekkladHLTFPE--TINAH-------WLAEGVLQLIPH-----------EEGNRSLVISAGIHGNETAPIEIL 61  Photorhabdus lu...
WP_010955173   6 KLLELTLTDHEPaEKTQVT--PKGARLR-----WLGEGALEVRPAe---------sDDCGLDLLLSAGIHGNETAPIELL 69  Pseudomonas putida
WP_011041483  32 DFIALTRQFEQG-FVQTGAdnQLSFKVKqakvsLLDTGVLLIEPEnvepelikeksATPSKSIVISSGIHGNETAPIEIV 110 Colwellia psych...
1YW6_A        69 DALLGAISHGEIPLRWRLLVILGNPPALKQGKRYCHSDXNRXFGGRWQLFAESGETCRARELEQCLEDFYDQGKESV--- 145 Escherichia coli
WP_011055562  65 NQLVTDLLAGQLPLSVRLLVLLGNPPAIRKGKRYLSNDINRMFGGRYQHYTPSDETRRASTLEQRVMAFFQASHTSE--- 141 Yersinia
WP_000368529  64 DALLGAISHGEIPLRWRLLVILGNPPALKQGKRYCHSDMNRMFGGRWQLFAESGETCRARELEQCLEDFYDQGKESV--- 140 Escherichia coli
WP_004925864  64 EHIYQDVFQASLTLNVRLLLVLGNPNAIRTGQRYIEYDMNRMFCGGYQQLEPSVETQRAERLEQHVQIFFEQGCSTAk-- 141 Acinetobacter
WP_004191679  81 STLVRDIARGALPLRCRLLVALGNPGAMRAGERYLDDDLNRLFGGRHAQLAASREAPRAAQLEAAAALFFSTAGRARg-- 158 Burkholderia ma...
WP_011147322  62 IQLLAQLAEGTLALKNNVLIIFGNLPAMRTNRRYLHDDLNRMFGGRYLNFPLGNERSRAAELENVVNRFFAEPSVSStn- 140 Photorhabdus lu...
WP_010955173  70 ERLLHGVANGKIRPRARVLFLFGNPAAIRKGERFIEQDINRLFNGRH-ELSSGFEALRAAELEQFARVFFSKPGRN---- 144 Pseudomonas putida
WP_011041483 111 QQLISDIIAQKIQVKHRTLLIMGNPVSMNIAKRFQTENLNRLFCGKYQDIDPCFEKYRAEKLEGYVSDFFNAGTATNatd 190 Colwellia psych...
1YW6_A       146 ------------------RWHLDLHTAIRGSLHPQFGVLPQR-DIPWDEKFLTWLGAAGLEALVFHQEPGGTFTHFSARH 206 Escherichia coli
WP_011055562 142 ------------------RLHYDLHTAIRGSYHPRFGLLPYQ-QTPYSAAMFRWLRDIELDALVMHTSAGGTFAHFSSER 202 Yersinia
WP_000368529 141 ------------------RWHLDLHTAIRGSLHPQFGVLPQR-DIPWDEKFLTWLGAAGLEALVFHQEPGGTFTHFSARH 201 Escherichia coli
WP_004925864 142 ------------------RYHYDLHTAIRASLLPTFALLPHL-EHVHDPLLLNSLNAADLDAVVFHNTAGKTFSHFSGAY 202 Acinetobacter
WP_004191679 159 -----------------aRWHIDMHTAIRTSVFEQFALLPHT-GEPPTRTMFEWLGEAQIAAVLLHTTKGSTFSHFTAQA 220 Burkholderia ma...
WP_011147322 141 -----------------iRWHIDLHTAIRASHHEQFALLPAQ-NRPFSAEFMQWLHDSDIDALVYHREKAGTFSHFLSEK 202 Photorhabdus lu...
WP_010955173 145 ------------------RLHYDLHTAIRGSKIEQFALYPYKeGRKHSRRELARLAAAGMEAVLLQSKSSITFSAFTYEQ 206 Pseudomonas putida
WP_011041483 191 ntsgntresqvtnsskmtNYHYDLHTAIRNSKYEKFAIYPYQaGKPWDKEQLSFMASCGVNTILFGHGPSGTFSYFSSAN 270 Colwellia psych...
1YW6_A       207 FGALACTLELGKALPFGQNDLRQFAVTASAIAALLSGESVGIVRT--P--PLR-YRVVSQITRHSPSFEXHXASDTLNFX 281 Escherichia coli
WP_011055562 203 CQAASCTLELGKALPFGENQLSQFSAITQGLRSLVSDSALPARKT--E--NMKyYRVVKSLLRQHPDFKLRVAEDTVNFT 278 Yersinia
WP_000368529 202 FGALACTLELGKALPFGQNDLRQFAVTASAIAALLSGESVGIVRT--P--PLR-YRVVSQITRHSPSFEMHMASDTLNFM 276 Escherichia coli
WP_004925864 203 CQAASATLELGQAKPFGQNDLSQFVAIDRVLRVLIADEALPSRHK--T--PIRrFKVIESILKKDDDFQLNLKSSAPNFS 278 Acinetobacter
WP_004191679 221 CGALACTLELGKVMPFGANDLSRFAPADAAVRRLVSGRRDAPRGA--L--P-RaFTVVDQITKQSDALELFVANDVPNFT 295 Burkholderia ma...
WP_011147322 203 FGADSCTMEMGKAMPFGENDLTRFQKITDALYGLISLSQITARIK--F--ELKhYQVINSIIKSHDSFQLHIPADTLNFT 278 Photorhabdus lu...
WP_010955173 207 LEAEAFTLELGKARPFGQNEQVNLDKLEERLIRII-EATEPEDESslD--GLQlFSVSREIIKHSDSFHLHLPADIENFS 283 Pseudomonas putida
WP_011041483 271 FSAHAFTIELGKVRPFGENNMANFQAMTNNLSALISDEAIPLKSF--DnnDFNlFEALGDITKVSDKFELYVADEASNFT 348 Colwellia psych...
1YW6_A       282 PFEKGTLLAQDGEE-RFTVTHDVEYVLFPNPLVALGLRAGLXLE 324 Escherichia coli
WP_011055562 279 RFAQGTLLTEQPND-NYRVEHPYEWILFPNPHVALGLRAGMMLV 321 Yersinia
WP_000368529 277 PFKKGTLLAQDGEE-RFTVTHDVEYVLFPNPLVALGLRAGLMLE 319 Escherichia coli
WP_004925864 279 LFHQGDVIATQQSQ-NYIAHEHEVRILFPNVNVAKGLRAGLILQ 321 Acinetobacter
WP_004191679 296 PFARGTLLARDGDY-RYAVRHEQERIVFPNPSVKPGLRAGLLVI 338 Burkholderia mallei
WP_011147322 279 ELPEGFEIASQHDH-HWKIKFPAKFILFPNAEVANglragllla 321 Photorhabdus luminescens
WP_010955173 284 ELSKGYLLAEDLAEmRWVVEEEGARIIFPNPKVKNGLRAGILIV 327 Pseudomonas putida
WP_011041483 349 DYPVGTLLSTDMNQ-EYRTTLLGESIVFPNANVGNGQRAVLMVV 391 Colwellia psychrerythraea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap