1YNH


Conserved Protein Domain Family
arg_catab_astB

?
TIGR03241: arg_catab_astB 
Click on image for an interactive view with Cn3D
succinylarginine dihydrolase
Members of this family are succinylarginine dihydrolase (EC 3.5.3.23), the second of five enzymes in the arginine succinyltransferase (AST) pathway. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 132285
View PSSM: TIGR03241
Aligned: 9 rows
Threshold Bit Score: 833.639
Threshold Setting Gi: 490297156
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YNH_A        14 AWEVNFDGLVGLTHHYAGLSFGNEASTRHRFQVSNPRLAAKQGLLKMKALADAGFPQAVIPPHERPFIPVLRQLGFSGSD 93  Escherichia coli
WP_011135052   3 AYEVNFDGLVGPTHNYSGLSFGNVASTSNVSAASNPKLAAKQGLQKMKALYDLGFKQGVLAPQERPDVASLRRLGFGGSD 82  Chromobacterium...
WP_004925865   3 GYEINFDGLVGPTHHYAGLSFGNEASTKNRNHLSNPKLAAKQGLLKMKALADMGMKQGVLAPQERPHVPSLRKLGFGGDD 82  Acinetobacter
WP_011395855   4 AFEVNFDGLVGPTHNYSGLSYGNVASETNIRDVSNPKEAAKQGLRKMKALHDMGFKQGVLLPQERPDIATLRRLGFTGSD 83  Hahella chejuensis
AAM85904      12 GYEVNFDGLVGLTHHYAGLSFGNEASTTHQNRTSNPRLAAKQGLLKMKALADLGYKQGVLPPQERPAIGVLRKLGFSGSD 91  Yersinia pestis...
WP_000995025   3 AWEVNFDGLVGLTHHYAGLSFGNKASTRHRFQVSNPRLAAKQGLLKMKTLADAGFPQAVIPPHERPFIPVLRQLGFSGSD 82  Escherichia coli
WP_011147323   3 GFEANFDGLVGMTHHYAGLSVGNKASINNKDSVSNPRKAALQGLMKMKALADEGFIQGVLPPQQRPHIPALRNLGFVGSD 82  Photorhabdus lu...
WP_004192611   3 AKEANFDGLVGPTHNYAGLSFGNVASLSNEKSDANPKAAAKQGLRKMKQLADLGFAQGVLPPQERPSLRLLRELGFSGKD 82  pseudomallei group
WP_010955174   3 SYEVNFDGLVGPTHNYGGLSYGNVASQSNSQQASNPREAARQGLAKMKALADMGFKQGVLAPQERPDVAALRRLGFSGSD 82  Pseudomonas putida
1YNH_A        94 EQVLEKVARQAPHWLSSVSSASPMWVANAATIAPSADTLDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVH 173 Escherichia coli
WP_011135052  83 AEVIARAAKEAPTILAAATSASCMWTANAATVSPSADTADGRVHFTPANLNNKFHRSIEHPTTRRVLRAMFADETRFAVH 162 Chromobacterium...
WP_004925865  83 HAVITQAMRTSPELLSALSSASCMWTANAATVSPSADSADGRVHFTAANLNNKFHRSIEHETTSQILAAIFRDERYFAHH 162 Acinetobacter
WP_011395855  84 REVLLQAAHQAPVFLGAVASASCMWTANAATVSPSADTTDGRVHFTAANLNAKFHRSIEHPTTTRILQGIFNNDQYFAHH 163 Hahella chejuensis
AAM85904      92 EQVLSDVARNAPRLLSAVSSASSMWTANAATVSPSADSADGRVHFTVANLHNKFHRAIEAETTAVLLPAVFNNHRHFVHH 171 Yersinia pestis...
WP_000995025  83 EQVLEKVVRQAPHWLSSVSSASPMWVANAATIAPSADTLDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVH 162 Escherichia coli
WP_011147323  83 EQILHKAAKYSPVLLSKLSSASSMWTANAATVSPSADSADQRVHFTVANLNNKLHRSLEIATTTAALKATFADQNYFVHH 162 Photorhabdus lu...
WP_004192611  83 ADVIAKAARQAPELLAAASSASAMWTANAATVSPSADTSDARVHFTPANLCSKLHRAIEHESTRRTLAAIFADEARFAVH 162 pseudomallei group
WP_010955174  83 AEVIQRAAREAMPLLVASCSASSMWVANAATVSPSADTADGRVHFTAANLNCKYHRSIEHPTTSRVLGAMFNDEKYFAHH 162 Pseudomonas putida
1YNH_A       174 SALPQVALLGDEGAANHNRLGGHYGEPGMQLFVYGREE--GNDTRPSRYPARQTREASEAVARLNQVNPQQVIFAQQNPD 251 Escherichia coli
WP_011135052 163 EALPAQMHFGDEGAANHTRFCADYGQPGVEFFVFGAAAfdMRYPKPAKFPARQTLEASQAVARLHGLSEAGVVYAQQDPD 242 Chromobacterium...
WP_004925865 163 LALPPVALFGDEGAANHNRLGGPYDSAAVQVFVYGQQFl-GGQVAPKRYPARQSLEACQAVARLHQLDSNRTVFVQQNPD 241 Acinetobacter
WP_011395855 164 KALPPTSQFGDEGAANHTRFCKNYEDKGVELFVYGRVAfdENAPRPMKYPARQTLEACQAVARLHGLADSSVVYAQQNPA 243 Hahella chejuensis
AAM85904     172 DALPSVTLLGDEGAANHNRLGGEYDSPAIQMFVYGRQGm-ESGAVPGRYPARQTREASQAVARLHQLDPKRTVFVQQNPA 250 Yersinia pestis...
WP_000995025 163 SALPQVALLGDEGAANHNRLGGHYGEPGMQLFVYGREE--GNDTRPSRYPARQTREASEAVARLNQVNPQQVIFAQQNPD 240 Escherichia coli
WP_011147323 163 QALPQHEDFGDEGAANHNRLGGDYDSPGVQVFVYGRSVf-RGGPVPKRYPARQTLEASEAIARLHRLNPAQTVFVQQNPV 241 Photorhabdus lu...
WP_004192611 163 DALPGTPALGDEGAANHTRFCAEYGAPGVEFFVYGRAEy-RRGPEPTRFPARQTFEASRAVAHRHGLREEATIYAQQRPD 241 pseudomallei group
WP_010955174 163 AALPAVAQFGDEGAANHTRFCRAYGEAGVEFFVYGRSAfdSRYPAPQKYPARQTLEASQAVARLHGLSDDGVVYAQQNPA 242 Pseudomonas putida
1YNH_A       252 VIDQGVFHNDVIAVSNRQVLFCHQQAFARQSQLLANLRARVNG----FMAIEVPATQVSVSDTVSTYLFNSQLLSRDDGS 327 Escherichia coli
WP_011135052 243 TIDAGVFHNDVISVGNGEVLFHHQQAFLNQADVLDEIARKLEArggrFTAIEVPRAEVTVEEAVKSYLFNSQLLSKPGGK 322 Chromobacterium...
WP_004925865 242 VIDEGVFHNDVIAVSNQQVLFHHQKAFFNQAQALNEIREKMALleqdLIAIEVPDQRVSVGDAVSTYLFNSQLITRPDGG 321 Acinetobacter
WP_011395855 244 VIDQGVFHNDVIAVGNRNVLFYHEQAFLNTSQMLTELEGKLQGc--lLKAVKVSDSEVSVADAVSSYLFNSQLLSLNDDD 321 Hahella chejuensis
AAM85904     251 VIDQGVFHNDVIAVSNRNVLFHHELAFLSSTQVMDDIRCKMAGleqqLVNIEVPEAEVSVADAVSTYLFNSQLLHKANGK 330 Yersinia pestis...
WP_000995025 241 VIDQGVFHNDVIAVSNRQVLFCHQQAFARQSQLLANLRARVNG----FMAIEVPATQVSVSDAVSTYLFNSQLLSRDDGS 316 Escherichia coli
WP_011147323 242 AIDSGVFHNDVIAVSNRNVLFHHQYAYLNQSQVLTEIRQKMAVlgqnFVSIEVPAEQISIKDAVDSYLFNSQLLSKIDGK 321 Photorhabdus lu...
WP_004192611 242 VIDAGVFHNDVIAVGNRDTLFCHEHAFVDRQAVYDALAASLGAlgaqLNVIEVPDRAVSVADAVGSYLFNSQLLAREDGT 321 pseudomallei group
WP_010955174 243 VIDQGVFHNDVISVGNGEVLFYHEDAFLETDAVLGQLRAKLASkggnFQAICVPRAAVAVEDAVRSYLFNSQLLSREDGS 322 Pseudomonas putida
1YNH_A       328 MMLVLPQECREHAGVWGYLNELLAA-DNPISELKVFDLRESMANGGGPACLRLRVVLTEEERRAVNPAVMMNDTLFNALN 406 Escherichia coli
WP_011135052 323 MLIVVPEECRNSERVWSYLQKLAAS-GGPIDEVRVFDLKQSMQNGGGPACLRLRVALNQAELAAVNPKVLMSDALFASLN 401 Chromobacterium...
WP_004925865 322 MTIVVPEESRQNLAVWSYLNDMIQM-GTPVDQIKVFDLRESMRNGGGPACLRLRVAVNDAEFNAINHNVLMNDALFARLN 400 Acinetobacter
WP_011395855 322 MMLVVPHECRDNPNVKAYLDDLVTR-GGPIKRVEVFDLKQSMKNGGGPACLRLRVALTEAELAAVHPHVMMSDGLFDTLN 400 Hahella chejuensis
AAM85904     331 MLLVIPQESQDNPSVWRYLSELVSG-DGPIDELRVFDLRESMRNGGGPACLRLRVVLNDAELQAVNSRVMLTPALFVTLN 409 Yersinia pestis...
WP_000995025 317 MMLVLPQECREHAGVWGYLNELLAA-DNPISELKVFDLRESMANGGGPACLRLRVVLTQEERRAVNPAVMMNDTLFNALN 395 Escherichia coli
WP_011147323 322 MVLVVPEECRQHSAVWDYLQSLSAQtSAPINEVRVFDLRESMRNGGGPACLRLRVVLNDAEFRAVNPATLMNTQLYQRLT 401 Photorhabdus lu...
WP_004192611 322 QMLVVPQECRENANVAAYLDALVAG-NGPIRDVRVFDLRESMKNGGGPACLRLRVVLNDAERAAVKPNVWIGDALFASLD 400 pseudomallei group
WP_010955174 323 MLLVVPEECRNNERVWAYLGQLTSQ-GGPVKEVKVFDLKQSMQNGGGPACLRLRVALKEAELAAVNQGVIMTATLYDTLL 401 Pseudomonas putida
1YNH_A       407 DWVDRYYRDRLTAADLADPQLLREGREALDVLSQLLNLGSVYPFQ 451 Escherichia coli
WP_011135052 402 GWVDRHYRDRLAPEDLADPQLLIECRGALDELTGILGLGSVYPFQ 446 Chromobacterium violaceum
WP_004925865 401 TWVDRRYRDQLSHQDLADPALLIESRSALDELTQILNLGSVYHFQ 445 Acinetobacter
WP_011395855 401 AWVDKHYRDRISQQDLADPQLLTECRTALDELTQLLQLGSLYPFQ 445 Hahella chejuensis
AAM85904     410 NWVDQHYRDHLQFKDLADPHLLQEGRQALDELTRILNLGPVYPFQ 454 Yersinia pestis KIM10+
WP_000995025 396 DWVDRYYRDRLTAADLADPQLLREGREALDVLSQLLNLGSVYPFQ 440 Escherichia coli
WP_011147323 402 KWIEHHYRDELCASDLADPQLLCEVYTALDELTQILNLGSIYEFQ 446 Photorhabdus luminescens
WP_004192611 401 AWIDKHYRDRLSPVDLADPALLDESRTALDELTQILGLGSLYDFQ 445 pseudomallei group
WP_010955174 402 QWVDRHYRDRLGEADLADPQLLVECRTALDELTQILKLGSVYPFQ 446 Pseudomonas putida
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap