4KNA


Conserved Protein Domain Family
arg_catab_astD

?
TIGR03240: arg_catab_astD 
Click on image for an interactive view with Cn3D
succinylglutamate-semialdehyde dehydrogenase
Members of this protein family are succinylglutamic semialdehyde dehydrogenase (EC 1.2.1.71), the fourth enzyme in the arginine succinyltransferase (AST) pathway for arginine catabolism. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 274486
View PSSM: TIGR03240
Aligned: 11 rows
Threshold Bit Score: 749.236
Threshold Setting Gi: 499221941
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4KNA_A        12 LFIDGAWVDGAGPVFASRNPGTNERVWEGASASADDVERAVASARRAFAAWSALDLDARCTIVKRFAALLVERKEALATM 91  Burkholderia th...
WP_011147324   6 HYIGGRWIEGQGESITKFSPIDQQVLWQANSADASQVRAACHAAREAFYAWSHLPASERIKVIQTFAALLNEEKETLARV 85  Photorhabdus lu...
WP_000177231   3 LWINGDWITGQGASRVKRNPVSGEVLWQGNDADAAQVGQACRAARAAFPRWARLSFAERQAVVERFAGLLERNKGELTAI 82  Escherichia coli
WP_011235542   6 QFIDGCWEAGEGQLFKSIDPARNEVIWSGEAASETQVEKAILAARAAFPDWSGRSVEERLAICQKFSELLEENKEHLART 85  Idiomarina loih...
WP_011395854   7 AFVNGRWLAGGGVEFESLDPVTQDCLWKGAAASDDVVGQAVQAARQAFTSWGRLDVSRRIDIVKRFAELLEEDKERLADV 86  Hahella chejuensis
WP_002212030  17 LFIQGEWRIGNGVSFEKQDPMSQQRLWQARAADHTDVTLACHAARAAFPAWARASLEQRATVIQQFAALLEQHKQSLART 96  Yersinia
WP_010955175   4 HYIAGNWQAGQGETLQSLNPVTQAVIWQGQGADASQVDAAVQAARQAFPAWAQLSLEARIDVLEKFAAQLKVHAEAMAQC 83  Pseudomonas putida
WP_004193383   4 LFIDGAWRDGAGPVFASRNPGTGEPVWEGAGASADDVERAVASARRAFAAWSALDLDARCAIVKRFAALLVERKEALATM 83  pseudomallei group
WP_011135051   4 LFIDGKWLAGDGEAMAKTNPADNAPLWQGRAASAAQVDAAVRAARAAFPAWARMGLEERAKVVRRFGERLTERKAELARV 83  Chromobacterium...
WP_010919481   5 LFIDGKWRAGQGAGLSSTDPATGEDVWSAATATPADVADAVAAARKAFPAWADRPREERIAILRRYKDILVERAAPYAEA 84  Caulobacter vib...
WP_011041484   8 QFINGQWQAGLGHDVSSSNPARNEVIWQGKTASKDQVNDAVLSARQAFESWANISLEARVAVVTKFAELLAENKDALATT 87  Colwellia psych...
4KNA_A        92 IGRETGKPLWEARTEVASMAAKVDISITAYHERTGEKRAPMADGVAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALIAG 171 Burkholderia th...
WP_011147324  86 ISQETSKPLWETRTEIQSMIGKAAISIEAWEQRTGESETIMPDGRALLRHRPHGVMAVFGPYNFPGHLPNGHIIPALIAG 165 Photorhabdus lu...
WP_000177231  83 IARETGKPRWEAATELTAMINKIAISIKAYHVRTGEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAG 162 Escherichia coli
WP_011235542  86 MAKETGKPVWETRTEVGAMMGKVAISERAYHERTGTVENDMPGAKAFIRHKPHGVVAVYGPYNFPGHLPNGHIVPALIAG 165 Idiomarina loih...
WP_011395854  87 IGKETSKPLWEARTEVASMVAKVGISIQAFNERTGVSEQDVAAGHAVLKHRPHGVLAVFGPYNFPGHLPNGHIVPALIAG 166 Hahella chejuensis
WP_002212030  97 ISLETSKPYWETLTEVQAMIGKVAISLQAYQTRTGHSQTPMGDSMSVLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAG 176 Yersinia
WP_010955175  84 IGEETGKPLWESATEVTSMINKVAISVQSYRERTGEKSGPLADATAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAG 163 Pseudomonas putida
WP_004193383  84 IGRETGKPLWEARTEVASMAAKVDVSIAAYHERTGERRSPTADGVAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALIAG 163 pseudomallei group
WP_011135051  84 IAQETGKPLWEATTEVTTMVGKIDISLKALAERTGERAAAMGDAQAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAG 163 Chromobacterium...
WP_010919481  85 LSRETGKALWETRAELASMAGKVDLSIRAYDERTGVTENAMPFGRAVLRHRAHGVMAVLGPFNFPGHLPNGHIVPALLAG 164 Caulobacter vib...
WP_011041484  88 IALETGKPKWETTGEAGAMVAKVAISLKAYNERTGTVENPMPGAKAFIRHKPHGVVAIFGPYNFPGHLPNGHIVPALIAG 167 Colwellia psych...
4KNA_A       172 NTVVFKPSELAPGVARATVEIWRDAGLPAGVLNLVQGEKDTGVALANHRQIDGLFFTGSSDTGTLLHKQFGGRPEIVLAL 251 Burkholderia th...
WP_011147324 166 NTLVFKPSELTPMTAEETVKLWEKAGLPAGVLNLVQGARSTGTALLEDKQIDGVLFTGSANTGFHFHRMLGGQPEKMLAL 245 Photorhabdus lu...
WP_000177231 163 NTIIFKPSELTPWSGEAVMRLWQQAGLPPGVLNLVQGGCETGQALSALEDLDGLLFTGSANTGYQLHRQLSGQPEKILAL 242 Escherichia coli
WP_011235542 166 NTVVFKPSELTPMVAQETVKLWEKAGIPAGVLNLVQGEVDTGKALSAHPQIDGLYFTGSSNTGHLLHKQFGGRPDKILAL 245 Idiomarina loih...
WP_011395854 167 NTIVFKPSELTPWFAEETVRIWAKAGLPDGVLNLVQGARETGVALAANDGIDGLLFTGSSPTGHSLHRQFGGRPEKILAL 246 Hahella chejuensis
WP_002212030 177 NTVVFKPSELTPWTAEETVKLWQQAGIPDGVLNLVQGGRETGEALAAQPDIDGLLFTGSAHTGYHLHRQLAGQPEKMLAL 256 Yersinia
WP_010955175 164 NCVVFKPSELTPKVAELTVNCWIAAGLPAGVLNLVQGARETGVALAANPGIDGLFFTGSSRTGNLLHQQFAGRPDKILAL 243 Pseudomonas putida
WP_004193383 164 NTVVFKPSELAPGVARATVEIWRDAGLPAGVLNLVQGEKDTGVALANHRQIDGLFFTGSSDTGTLLHRQFGGRPEIVLAL 243 pseudomallei group
WP_011135051 164 NSVIFKPSELTPWTAEETVKLWAEAGLPAGVIGLVQGAKDTGVALAGHEGLDGLFFTGSSATGALLHKQFSGRPDKILAL 243 Chromobacterium...
WP_010919481 165 DTVVFKPSEETPLAGQLMVEALEAAGAPAGVVNLVQGGRETGQALIAQ-DIDGLLFTGSAAAGTYFRRYFADRPDVILAL 243 Caulobacter vib...
WP_011041484 168 NTIVFKPSELTPRVAQEMLKLWEQAGLPNGVINLVQGEVETGKALASHKLIDGLFFTGSSNTGHILHEQFAGQPGKILAL 247 Colwellia psych...
4KNA_A       252 EMGGNNPLVVAEVED-IDAAVHHAIQSAFLSAGQRCTCARRILVPRGAFGDRFVARLADVASKITASVFDADPQPFMGAV 330 Burkholderia th...
WP_011147324 246 EMGGNNALIVDAYDD-IDAAVYTIVQSAFISAGQRCTCARRLLVKNGAHGDAVIKRLVEVTERIVPSHWDAQPQPFIGGV 324 Photorhabdus lu...
WP_000177231 243 EMGGNNPLIIDEVAD-IDAAVHLTIQSAFVTAGQRCTCARRVLLKSGAQGDAFLARLVAVSQRLTPGNWDDEPQPFIGGL 321 Escherichia coli
WP_011235542 246 EMGGNNPLLVTNVAD-VDAAVHNIVQSAFITSGQRCTCARRLFIEDSEQGRAVLERLIEVTENILVDDYEADPQPFMGAM 324 Idiomarina loih...
WP_011395854 247 EMGGNNPLIIAPPYD-LKGAVHHTLFSAFVSAGQRCTCARRLLVPDTAEGQAFLDELIAAAANLQVGRYDADPQPFMGGV 325 Hahella chejuensis
WP_002212030 257 EMGGNNALIVEQVKD-RDAVVNLAIQSAFISAGQRCTCSRRLLVKTGAEGDAFLLRFTAVAQALRIGRWDEQPAPFMGAV 335 Yersinia
WP_010955175 244 EMGGNNPLVVDEVKD-LDAAVYTIIQSAFISAGQRCTCARRLLVPQGAWGDALIARLVEVCKTITVGAFDEQPAPFMGSV 322 Pseudomonas putida
WP_004193383 244 EMGGNNPLVVADVED-IDAAVHHAIQSAFLSAGQRCTCARRILVPRGAFGDRFLERFADVASRITADVYDADPQPFMGAV 322 pseudomallei group
WP_011135051 244 EMGGNNPLIVGEVAD-VDGAVHHVIQSAFVSAGQRCTCARRLLVPQGEWGDAFVARLVEVAGKLRVGKFDAEPAPFLGAV 322 Chromobacterium...
WP_010919481 244 ELGGNNPLVVWNADDaPEAVAALIVQSAFITTGQRCSCARRLIVPDDASGAAIIEATVALAERLVIGAWNAENEPFMGPL 323 Caulobacter vib...
WP_011041484 248 EMGGNNPLVVKDVSD-IDAVVHDIVQSAFVTTGQRCTCARRLFIEANEQGDAILARLIEVTKNLTIGYYDDEAQPFMGSM 326 Colwellia psych...
4KNA_A       331 ISARAASRLVAAQARLVGLGASPIIEMKQRDP-ALGFVNAAILDVTN-VRELPDEEHFGPLAQIVRYTDLDDAIARANDT 408 Burkholderia th...
WP_011147324 325 ISLQAVQNLLEAQDRLQKLGGISLVSLEQCQP-QSTLLTPGIIDVSQ-VADVPDEEYFGPLLMLMRYDTFDEALAIANNT 402 Photorhabdus lu...
WP_000177231 322 ISEQAAQQVFTAWQQLEAMGGRTLLAPRLLQA-GTSLLTPGIIEMTG-VAGVPDEEVFGPLLRVWRYDSFEEAIRMANNT 399 Escherichia coli
WP_011235542 325 ISAKAAGEMVDAQNELLHKGAKSLVRMKQTDS-KKGFVTPGIVDVTG-VEDLPDEEHFGPLLKVYRFKDIDAAIKEANNT 402 Idiomarina loih...
WP_011395854 326 ISLRARDQMLAAQNKLAAEGGRILLEMRSLEE-NASLLSPGVIDVTD-VQELPDEEHFGPMLQVLRYRDFDHALELANKT 403 Hahella chejuensis
WP_002212030 336 ISSQAAERMLAAQQHLLLLGGESLLNMTRPDS-QSALLTPGIIDITN-ISEVPDEEYFGPLVSVIRYTDFTEALKIANQT 413 Yersinia
WP_010955175 323 ISLQAARALLAAQVELAAKGGVKLLEMTQPQA-DAALLTPGIVDVTA-VADRPDEEFFGPLLQVIRYADFDAAIDEANNT 400 Pseudomonas putida
WP_004193383 323 ISARAASRLVAAQAKLLELGAAPIIEMRQRDP-ALGFVNASILDVTP-VRELPDEEHFGPLAQIVRYTDLDDAIARANDT 400 pseudomallei group
WP_011135051 323 ISNAAADALLKAQDDLVAAGGTPLLAMRRLEE-GAAMLTPGIIDTTA--AVRPDEEFFGPLLQVIRYADFDQAIAIANDT 399 Chromobacterium...
WP_010919481 324 ISGRAAK---AAREVASATPGKTILALDGVAGlGDAFLKPGIVDVTG-L-ETPDEELFAPLLQVRRVSSFDEALAAANAT 398 Caulobacter vib...
WP_011041484 327 ISEKAALSLVDAQAKLLALGAKSVLDLKHLEV-GTGFVSPGIIDVSDiIADIPDEEYFGPLVKLYRYNDFDKAIDEANNT 405 Colwellia psych...
4KNA_A       409 AFGLSAGLLADDEQAWHTFRRAIRAGIVNWNRPTNGASSAAPFGGAGRSGNHRPSAYYAADYCAYPMASVESAQLQMPAS 488 Burkholderia th...
WP_011147324 403 RFGLATGLISPDAALFQRLSEDARAGIVNWNKPLTGASSKAPFGGIGASGNYRPSAYYAADYCAWPMASLVADELTLPET 482 Photorhabdus lu...
WP_000177231 400 RFGLSCGLVSPEREKFDQLLLEARAGIVNWNKPLTGAASTAPFGGIGASGNHRPSAWYAABYCAWPMASLESDSLTLPAT 479 Escherichia coli
WP_011235542 403 RYGLSAGVLCDDEQTYRYFFKHIRAGIVNWNKPITGASSAAPFGGIGASGNHRASAYYAADYCAYPVASVEADSMSLPES 482 Idiomarina loih...
WP_011395854 404 GFGLAAGLISDSRDLYDRFWLEVRAGIVNWNKPLTGASSAAPFGGVGASGNHRPSAYYAADYCAYPVATLEADQAQAPAQ 483 Hahella chejuensis
WP_002212030 414 RFGLAVGLVSEDRQQFEQLLLEARAGIVNWNKPLTGASSAAPFGGVGASGNHRPSAFYAADYCAWPMASLECEHLTLPAT 493 Yersinia
WP_010955175 401 QYGLAAGLLSDSRARYQYFWLRSRAGIVNWNKQLTGAASSAPFGGVGASGNHRASAYYAADYCAYPVASLETASLALPAT 480 Pseudomonas putida
WP_004193383 401 AFGLSAGLLADDETVWNTFRRTIRAGIVNWNRPTNGASSAAPFGGAGRSGNHRPSAYYAADYCAYPMASVESAQLQMPAN 480 pseudomallei group
WP_011135051 400 RFGLAGGVLSDSRELYDRYWLESRAGVVNWNKPLTGASSAAPFGGIGASGNHRPSAYYAADYCAYPVASLECDSLALPAQ 479 Chromobacterium...
WP_010919481 399 RYGLSAGLISNESELWDKFLSRIRAGVVNWNRPTTGAAGSMPFGGLGASGNHRPSAYYAADYCAYPVASFEASMVVDTLK 478 Caulobacter vib...
WP_011041484 406 GFGLSAGLLSDSEASYNHFFTRIRAGIVNWNKPITGASSAAPFGGIGASGNHRASAFYAADYCAYPIASVEAEKVSLPET 485 Colwellia psych...
4KNA_A       489 LSPGLHF 495 Burkholderia thailandensis E264
WP_011147324 483 LAPGLHF 489 Photorhabdus luminescens
WP_000177231 480 LNPGLDF 486 Escherichia coli
WP_011235542 483 LAPGLKF 489 Idiomarina loihiensis
WP_011395854 484 LSPGMSL 490 Hahella chejuensis
WP_002212030 494 LSPGISF 500 Yersinia
WP_010955175 481 LTPGVTL 487 Pseudomonas putida
WP_004193383 481 LSPGLHF 487 pseudomallei group
WP_011135051 480 LSPGIVL 486 Chromobacterium violaceum
WP_010919481 479 DIKGLKA 485 Caulobacter vibrioides
WP_011041484 486 LTPGMKF 492 Colwellia psychrerythraea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap