1DXE


Conserved Protein Domain Family
GarL

?
TIGR03239: GarL 
Click on image for an interactive view with Cn3D
2-dehydro-3-deoxyglucarate aldolase
In E. coli this enzyme (GarL) 2-dehydro-3-deoxyglucarate aldolase acts in the catabolism of several sugars including D-galactarate, D-glucarate and L-idarate. In fact, 5-dehydro-4-deoxy-D-glucarate aldolase is a synonym for this enzyme as it is unclear in the literature whether the enzyme acts on only one of these or, as seems likely, has no preference. (Despite the apparent large difference in substrate stucture indicated by their names, 2-DH-3DO- and 5-DH-4DO-glucarate differ only by the chirality of most central hydroxyl-bearing carbon and is alternately named 2-DH-3DO-galactarate.) The reported product of D-galactarate dehydratase (4.2.1.42) is the 5DH-4DO-glucarate isomer and this enzyme is found proximal to the aldolase in many genomes (GenProp0714) where no epimerase is known. Similarly, the product of D-glucarate dehydratase (4.2.1.40) is again the 5-DH-4DO isomer, so the provenance of the 2-DH-3DO-glucarate isomer for which this enzyme is named is unclear.
Statistics
?
PSSM-Id: 132283
View PSSM: TIGR03239
Aligned: 6 rows
Threshold Bit Score: 432.336
Threshold Setting Gi: 489909496
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1DXE_A         8 NKFKAALAAKQVQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDISTFIPQLMALKGSASAPVVRVPTNEPVIIKRL 87  Escherichia col...
WP_011095077   8 NRFRQDLQQGKTLIGCWCALGNPISTEVLGLAGFDWLVLDGEHAPNDIVTFIPQLMALKGSHSAPVVRPPCNEPIIIKRL 87  Pectobacterium ...
WP_011199870   8 NQFRQKLLKGETLIGCWCALGNPITAEVLGLAGFDWLLFDGEHAPNDVLSFIPQLMAVKDSASMPIVRVPKNEPVIIKRV 87  Mannheimia succ...
WP_001551692   8 NKFKAALAAKQVQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDISTFIPQLMALKGSASAPVVRVPTNEPVIIKRL 87  Escherichia coli
WP_011297665  18 NRFRADILARKRLIGLWSSLGQPVTSEIIGLAGFDWLLLDGEHSPNDVLTLAPQLMALKDSVSAPVVRPPWNDPVMIKRL 97  Cupriavidus pin...
WP_003812911  10 NRFRQRILAREQLIGYWLSLASHITAEVAGMADFDWLLLDAEHSPNDVPLLLQQLQALQGSASAAVGRPSWNDPVEIKRM 89  Bordetella bron...
1DXE_A        88 LDIGFYNFLIPFVETKEEAELAVASTRYPPEGIRGVSVSHRANMFGTVADYFAQSNKNITILVQIESQQGVDNVDAIAAT 167 Escherichia col...
WP_011095077  88 LDIGFNNFLIPFVETAEEAARAVASTRYPPAGIRGVSVAHRSNSYGTEPDYFAKINDNITVVVQIESQDGLDNLDAIIAV 167 Pectobacterium ...
WP_011199870  88 LDIGFYNVLVPYVESKEEAEEAVSATRYPPEGIRGVSVSHRNNGYATIPDYFKVINDNIGVIVQIESQKGVDNVDEIAAV 167 Mannheimia succ...
WP_001551692  88 LDIGFYNFLIPFVETKEEAEQAVASTRYPPEGIRGVSVSHRANMFGTVADYFAQSNKNITILVQIESQQGVDNVDAIAAT 167 Escherichia coli
WP_011297665  98 LDIGFYNFLIPFVESAEEARRAVRATRYPPDGIRGVSGVQRQNRFGTLPDFFKTINDNICVLVQIESRKGVEAVAEICAE 177 Cupriavidus pin...
WP_003812911  90 LDIGFYNLLIPFIESADDARRAVAATRYPPQGMRGVSVAQRSNRYGTVTDYLRTINDNICVLLQIESRPGVEAVDEIAAV 169 Bordetella bron...
1DXE_A       168 EGVDGIFVGPSDLAAALGHLGNASHPDVQKAIQHIFNRASAHGKPSGILAPVEADARRYLEWGATFVAVGSDLGVFRSAT 247 Escherichia col...
WP_011095077 168 DGVDGVFVGPSDLSAALGYLGQPNHPDVQKAIRHIFDRAAAHNKPCGILAPVEADARRYLEWGASFVAVGSDLGVFRSAT 247 Pectobacterium ...
WP_011199870 168 NGVDCLFVGPGDLSAALGYLGQPNHPEVQKVIQHIFATAKKHGKPCGILAPVEADARRYLEWGATFVAVGSDLGVFRGAT 247 Mannheimia succ...
WP_001551692 168 EGVDGIFVGPSDLAAALGHLGNASHPDVQKAIQHIFNRASAHGKPSGILAPVEADARRYLEWGATFVAVGSDLGVFRSAT 247 Escherichia coli
WP_011297665 178 PGVDGIFIGPNDLAAAYGHLGNPNHPDVQAAVRQICDAANHAGKAIGTLTPVEADARRYLDMGAHFVAVGLDHVLLRDAA 257 Cupriavidus pin...
WP_003812911 170 DGVDGVFIGPSDLAAALGHLGNPGHPEVQEAIRHLHGRVAAQGKAVGILAPVQADARRYLDMGAHFVAVGSDLGVFKQAT 249 Bordetella bron...
1DXE_A       248 QKLADTFKK 256 Escherichia coli BW2952
WP_011095077 248 QALSDKYKK 256 Pectobacterium atrosepticum
WP_011199870 248 KALSEKFKG 256 Mannheimia succiniciproducens
WP_001551692 248 QKLADTFKK 256 Escherichia coli
WP_011297665 258 RALRERFAS 266 Cupriavidus pinatubonensis
WP_003812911 250 FALRAAFPA 258 Bordetella bronchiseptica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap