Conserved Protein Domain Family
dnd_assoc_3

?
TIGR03238: dnd_assoc_3 
DNA phosphorothioation-dependent restriction protein DptF
A DNA sulfur modification (phosphorothioation) system, dnd (degradation during electrophoresis), is sparsely and sporadically distributed among the bacteria. This protein is one member of a three-gene restriction enzyme cassette that depends on DNA phosphorothioation. [DNA metabolism, Restriction/modification]
Statistics
?
PSSM-Id: 132282
View PSSM: TIGR03238
Aligned: 3 rows
Threshold Bit Score: 658.518
Threshold Setting Gi: 447210917
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011329729  30 LDEVKEYLYIKMPIAIdveKKISSFSSNKP--EVLFLCGSSGDGKSEILT---DCKKKFSTRAHFHLDATHSFDPRENAI 104 Pseudoalteromon...
WP_011400713  38 IEALRSYLYVKTEIET---RFVDALNQRLPigTILFLCGSSGDGKSEILR---RHYDKFSVDNRFYLDATHSFKPDQNAV 111 Hahella chejuensis
WP_001288173 217 FSQFKKYMHVERKIQTdleRILVK-NKELNssSLILLCGSVGDGKSHLLAylnENKRELLEGYEIFNDATESFSPNKNAM 295 Bacillus cereus
WP_011329729 105 QTLDKVFDQF-----ESGTTPLIVGINTGMLGNY-----AEEGSN--DKFKKVIKDYLSNKTVT---EDIHFINFEDYPK 169 Pseudoalteromon...
WP_011400713 112 EALDQLFDEH-----NASNKPLIVGINIGMMFNF-----QNTGADrhAAIKEAIGRFIKGDRDV---GRYRFLSFEDYPK 178 Hahella chejuensis
WP_001288173 296 ETLEEILQGFsdqliNQSNKKVILAINMGVLHNFitldhQEFTYTalNKFVDSSGLFSSSVTTCygeDHFDLISFGDYHS 375 Bacillus cereus
WP_011329729 170 FFINEIGYTSEFAQKLLQKLTADDDNiiRQIFDKEKQQQTSQASIKLQaNYELLSIPEVQQTIIELLFKARLMRDQFLTA 249 Pseudoalteromon...
WP_011400713 179 FSLEEGKVGSDFISKLLAKVTASSSE--NPLYAAYLCDEKNHHKLEYQ-NYRILQEESVQKLIVKTLLYVRLKYDQFFSA 255 Hahella chejuensis
WP_001288173 376 YELTEEGPQSTFFLTLLNKIFNKEEG--NPFYLAYQEDVNKKVRTMVHeNYEFIQEPYVQKQIVNLIIQTLVKFKLVISA 453 Bacillus cereus
WP_011329729 250 RALLDFIFMLL-------------------AGPGYLFDNLFSGGDNELANKIIEFDPAHLRTKKIDRFILANDLNLPDQE 310 Pseudoalteromon...
WP_011400713 256 RAIMDFIHNLI-------------------AGDSILFDNLFSSSSGELSESLSHLDPCLRRTQKIDEFVVQRSLNISDRE 316 Hahella chejuensis
WP_001288173 454 RAFLNFVADIIipdklavikglsefevleqAVPSLMFKR---KERSPILKFLHELDPVHRRSSYIDQIIIDLS------T 524 Bacillus cereus
WP_011329729 311 FAEFK-QFMNNLGVEALEnSFSYLRLFY----------------ILKGGHFSNDYHVKFEQDFNESLIEQYINVYQLHRD 373 Pseudoalteromon...
WP_011400713 317 FEYFKiEYQARYGAVEMS-PRSWIRAFY----------------LLRYIDLGNNYHQKFSLDFENIIFEDYINIWQLHHS 379 Hahella chejuensis
WP_001288173 525 LNEWN-TVLNR--CVTSNkGRGWLNPFIgeekvdgpsfigfaetVIRITYLTNE---DFSQKIEDQTYHKYVK-----KL 593 Bacillus cereus
WP_011329729 374 FNnsseHKKQIKDFYNNTLRTAIRKYNNRNAPNLDKSHYLISELNG-YQLASELEIKADLKSISSFSPKSSASFIAFIKV 452 Pseudoalteromon...
WP_011400713 380 LS----DKKKLRGFYNKTLIASLTKFANRLVPKLVGDGLYLAERNG-VTISATVSIGMDSKALEESNSGQIHCFKAALKV 454 Hahella chejuensis
WP_001288173 594 FDfnsgNKKEIKVFYEE-IKDALYKW--KGSPQ--KGYIYLNKPSEkFRLAQFLNLKPSIEHLKFSPNNILESFKASISL 668 Bacillus cereus
WP_011329729 453 QDHP------LTIPVNINLLRLMKRVVDGYRPNKHDKNTVVLLDELIDEITRVANQVTTL--HIIRDNKHFTIkNVDDEE 524 Pseudoalteromon...
WP_011400713 455 EDKSi-----EPFPITVSFLELTERILAGYRPNRHDKNTVVILEEVVEKITKIASKSKAL--YFHKDGGDWSL-QFEDDE 526 Hahella chejuensis
WP_001288173 669 AYHNgdiketILLDIDYQLYCLLTKVCHGYRPNKKDEEDAIKFTEFVEKIMKFGEKKSELliHFPNDSRFYKLtRDDFDT 748 Bacillus cereus
WP_011329729 525 FEVSGL 530 Pseudoalteromonas haloplanktis
WP_011400713 527 FVAETY 532 Hahella chejuensis
WP_001288173 749 FVFERE 754 Bacillus cereus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap