Conserved Protein Domain Family
dnd_assoc_2

?
TIGR03237: dnd_assoc_2 
DNA phosphorothioation-dependent restriction protein DptH
A DNA sulfur modification (phosphorothioation) system, dnd (degradation during electrophoresis), is sparsely and sporadically distributed among the bacteria. This protein is one member of a three-gene restriction enzyme cassette that depends on DNA phosphorothioation. [DNA metabolism, Restriction/modification]
Statistics
?
PSSM-Id: 132281
View PSSM: TIGR03237
Aligned: 3 rows
Threshold Bit Score: 1839.9
Threshold Setting Gi: 499511949
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011329731    3 EKQFEEFLVSHF-NVWAAEELKVGFRYQFTSPDSDKGFALYQAFMKIADKSVTVKGIELK------TVQYGDVELIPVYE 75   Pseudoalterom...
WP_011400711    3 EKQFEGFLVNHL-KTWLAERLKPGDRFQFRSTDPVNTVRLLAALRDASDGSVQDEETPLS------YLNVNGIQVLIAGH 75   Hahella cheju...
WP_011198589    9 SNEFYNYICELLlGDFKNRSIKAGDRFYLQLDKVEDVDNLVEALQEQENVKQFVYKHELGevyktfSIEIQNIQLVIAYT 88   Bacillus cereus
WP_011329731   76 GEN-------FTENYIAHLRDVVsamegETKGTALLIIHNSMLDTLKNSTEDVAQPGVVWDPKNIKRLLHKEIDQTDEKA 148  Pseudoalterom...
WP_011400711   76 AEErkveygcYTDNYLAKLRDGV-----VDDDCALIMVHNSTLDTITNSTFDLAQTGAIWSVSKIRELLEGLIDDSMTNR 150  Hahella cheju...
WP_011198589   89 NKN-------VKPDFLVTLRNQVgeqksVWKETALLSIVSEQLDSIQGGSSDLQKDGMPLHPNSIVKGLRQEIESSMLDK 161  Bacillus cereus
WP_011329731  149 KVSECL---LDYHFDEIVEDEATMFGFEKLYYAIADGDLQ---FHELGLLKDDQLSqeG-WEGE-------QISLRLKEN 214  Pseudoalterom...
WP_011400711  151 QTSKCL---LDLQAKIVASDGSSIFGYRSLYESIIDGDLR---FDELGLFNDPHLT--GlWGGAttapnqrQIERRLEEN 222  Hahella cheju...
WP_011198589  162 TAQIILienMEMIKQEQAHQQVTFFEFEEIFSTLAKGTIEdkdYQKFAVFKDKELA--T-FKGN-------KQKERLGLN 231  Bacillus cereus
WP_011329731  215 KELSDKLDFITHHFPNELQD-KLAalDFSEKFIKEHFPDGniEKYKEsLDIGEC------FTEQQKNRTNLLELESEKAP 287  Pseudoalterom...
WP_011400711  223 RKLRSEIEFELEHYPTELED-RLS--KFGGKFVKDNFIDS--DDWKN-RTYDEF------ITEIQKQKKQALEFIDVDTA 290  Hahella cheju...
WP_011198589  232 REL--------YEFVRKIHDfGLGteELEKKFTPEGASKLkrEDWKE-MGFADVhrfhqdFIDLRKKASINLKGLTVKEG 302  Bacillus cereus
WP_011329731  288 YIELLKKAKSEKGAGVRERHLILILEPEQHTFELELCFINQ-----KLKDSFCKVQQSKEMPNVDITIKnPGGIRSRAVL 362  Pseudoalterom...
WP_011400711  291 SGNLQRRSKKETAAGQRDQNILLEVPTDQSTFQINLRFTGA-----RTEKSEFEIQPRKAAKLLELSHK-PRGNNTTLTI 364  Hahella cheju...
WP_011198589  303 -LHFWDKPQKETAAGERKRHLVIFNPECKEELHLNAAFSIQggnvkSLSNKYVKIPPTFK-KNVEVSV---GKINLNAVI 377  Bacillus cereus
WP_011329731  363 TSSFDGQARYFNFRVKTDKPKET-HNFKVLVISKNDFYIDGFKHTYLVDPAK--QWLTLQTDEQSLQISDLTNTs--TLA 437  Pseudoalterom...
WP_011400711  365 TGELTLEPLFFSVRTRREISSEL-FKFQCLVLPEGKFCFDDIINKYLIKATGrgQSLIIQSDVQILETNPNLDTs-iTLK 442  Hahella cheju...
WP_011198589  378 KTG-GNQPTFTRLAYKHDDKSTLgVELFIVVLPIEPYVLDAFKTTYLIAPNK--RLIELQHEDNELSFGQGYNKksiEVY 454  Bacillus cereus
WP_011329731  438 ENNQVFDS---NSVGIVDFKKLATESDEISFIVQGAI--SQLTFNVEGEVSTDTLSLPLLLDQGRFNHLFNDEYFGQYNR 512  Pseudoalterom...
WP_011400711  443 DNDEIIDV---NEIGNLDYQQIYDESDEVRFILKNGE--TELPIQIEGESAKESLTLPLLMDTSRTRYMFDDGYYGVYKE 517  Hahella cheju...
WP_011198589  455 EENATVDCgidDELTILPQPEAYNDEEEMRVNIRLTEngTIIPLILKNELPEST---PI---NGARIWKLKREQQRDFEW 528  Bacillus cereus
WP_011329731  513 SKNKVLIDGKEIAPKAKRLTLLQNEAELLDS-VILAKVTNGNDIKLQDLeAHYADLYFAYRDLFDYLVH-----TKSLLS 586  Pseudoalterom...
WP_011400711  518 SKGIVVVENQEVMQLFLRKQLLDAEWEIIASeLVFWDASQEKGLPASGL-TEFPELKNLHQSYIAFLQHfkaasRRTLPS 596  Hahella cheju...
WP_011198589  529 INNRLRFGNREFYLSPEYKNLFDWEYQWIEN-GFRCAVVESDVLVPEDL-SISDELREAYSRFLTYFKI-----KKGIPS 601  Bacillus cereus
WP_011329731  587 LSGWGVKLRALVTQIVETYQAAIDEIPYHAPLLEQHKLLVNIGFADFDE------QTYITPYHPLVLAYNCNLADILSND 660  Pseudoalterom...
WP_011400711  597 LEGWGPTLVGLARNYVENYLAYLESVERGKTLSPCTKFVMRLGTASIRDtednrvKNYLTPFHPLILSYYLYLIESIQAD 676  Hahella cheju...
WP_011198589  602 LCYYSDELVKRAEEYLNTFIQEIKSFEEGHEAGKRGRDLFKLGTVRGNN------VIKFTPFHPVMVAFQLKLNNLLSNE 675  Bacillus cereus
WP_011329731  661 KDATaSFKKLPPVTIQRLTAQGLLPFVYDPVHNFSYNHAEKENVFWSKLVPQQESSY----DFVRTLVKDKVGKFTTAFK 736  Pseudoalterom...
WP_011400711  677 GDEF-SFRSLPDVTLKRLNPRGLIPHLFDKEQKYSYTQSVDENAFWLEIVPREDSSF----DYISKLVRHKIEEFTETFS 751  Hahella cheju...
WP_011198589  676 --------EVDNSILQRLKPDGLVPYIYNERDQLYRPDNQNIALEWMDFKPVNQVSVsdanQYLAKVIEDKIQQFEGHFG 747  Bacillus cereus
WP_011329731  737 HLFVAGSKTTLIINSVNNQHNKEIFLGLIDYIKLKK-----NKVTNIHVNLYDETQCYTWFDKFADMASYDDLKELCELN 811  Pseudoalterom...
WP_011400711  752 RLFDTVSSAPILINSVNNAENHELFRGLLAYYMEHL-----EEGRYIHVNLYDDEEIETEFDLFAEMATYDDIKDRYDLD 826  Hahella cheju...
WP_011198589  748 YLFSEYSRAPLQINLINIENDHETFRGIVNWMLERIrskgpEGLKAVEVTLYKEEGQDSAFDNFSRIESVEEFQTKFNIN 827  Bacillus cereus
WP_011329731  812 KGAARE-QADSIIDLLRTRLTYSKFEHEKGQkEQHYAHMSFFKNNERVQATDVDLLKQETGVVCHGLMPGESASNKNGSY 890  Pseudoalterom...
WP_011400711  827 KGKAKR-NTDTIVDVLRTRLTFSKFPNGKSE-QQVYAHLTFFKNNQVVDARDNNIDEHLSGVACGGLLNGESSRSENDAY 904  Hahella cheju...
WP_011198589  828 LGAKQQhEPQDILRFIREKLFY--YKKEIGE-EYKYAHISFYKMQAQERYALQSMDEMLSGLAIDGLYTTVPSMKSNENY 904  Bacillus cereus
WP_011329731  891 YTSFGLKGIDVDSAPQLKLVAKYSGLIKPAKRH--HEEYSESKSQALVVTENFKTLLERSYENSIWTTIIDPKVTLEFFE 968  Pseudoalterom...
WP_011400711  905 FTAFGLKGVDYSNKPHLKIARIFGAMWRPSHLS--SDSFHEHSAISLAVSDSVKRLLDKSYDSSVWVTIVDPKVTLDFFS 982  Hahella cheju...
WP_011198589  905 KSGFGVKAYVVEDENLLTQTTYYFNELCANLHNggNNTYRKGEAIFSRTTSADEKTLEEIFKSSYWVTFVDPSFDLEFFN 984  Bacillus cereus
WP_011329731  969 S-QKNMVLIHYSDNYTNSVNYDAITVTKQTDLYHKVLE------------NDDGGIIEEFNAFNGEWLLNLVTANDNERK 1035 Pseudoalterom...
WP_011400711  983 N-TEDVILIHYSDQYTSSAGYDAITVTKQSQLYRSVLG------------ASGESLIREFNAFNGEWLLQMVNDLDKEKL 1049 Hahella cheju...
WP_011198589  985 DyEQNLVVIHYSDQYSSSSRYDAITVTDKSQQYHFVIEeflkekqveskkENVESTIKAFNTFNGEWLLRVIGSKGHYSR 1064 Bacillus cereus
WP_011329731 1036 EKRGIICAYKYVNCLVADSDITWVPLSIAEVIRVAGNLGLNMADSDLSRHAQGFKKGVISDDILFVGF----KGQQMILL 1111 Pseudoalterom...
WP_011400711 1050 GKEGVIASYKAVSAMLSQSDICWAPLSVAEMIRVAGNIGLAMSDSDFSRHNFGIKQGAISDDVLFAGF----KDGKLYLL 1125 Hahella cheju...
WP_011198589 1065 EKLSIISAIKFSLAYFEHSDILWVPISLEEVLRVAGTVNLKKADGIFTTKNLG-RNGVHSDDLLLIGLeqveNDLMMHFY 1143 Bacillus cereus
WP_011329731 1112 PVEVKTGKRQT--HSKGVEQAKELKQYFEALLGQQTLAGHLYRGLFMRQVLMQIDKYKLYKVYKEGYFNSIEQRSAQWLQ 1189 Pseudoalterom...
WP_011400711 1126 PVESKAGARPN--FEKARNQTRELKEYMEGLLGQKNLAGRLYRGLFIRQVLLQVEKYQLYKVFSDGYFDSLLSAREEWLE 1203 Hahella cheju...
WP_011198589 1144 PVEVKIGANKNdvLEKARKQVKHTKKLINDALTTNSFASRFYRNFFAQLYISNANKIFKSRFWKEKNYELNNKVVEKLLK 1223 Bacillus cereus
WP_011329731 1190 GDYELAELVEYPAGF-LFVNVEDRDFTKASFLKVHNILKVELPAGNLSHWVKTPMQNLLADLTPAKLHHIDAQYIL 1264 Pseudoalteromonas...
WP_011400711 1204 GTYELAQLKSYPAGI-VVAHLNTDSCVTERYEEIDGILEVDIPMSKLASLVHQPYERLKEELLAGRLLAVPDKYIL 1278 Hahella chejuensis
WP_011198589 1224 DQFTISNTIESSIGEgAILSFQRDAYHRSAKLD-EGITLLNLSEFDGYSGLIQPMEDMKNWIQETEGDFIKEELLS 1298 Bacillus cereus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap