Conserved Protein Domain Family
DNA_S_dndA

?
TIGR03235: DNA_S_dndA 
cysteine desulfurase DndA
This model describes DndA, a protein related to IscS and part of a larger family of cysteine desulfurases. It is encoded, typically, divergently from a conserved, sparsely distributed operon for sulfur modification of DNA. This modification system is designated dnd, after the phenotype of DNA degradation during electrophoresis. The system is sporadically distributed in bacteria, much like some restriction enzyme operons. DndB is described as a putative ATPase. [DNA metabolism, Restriction/modification]
Statistics
?
PSSM-Id: 163191
View PSSM: TIGR03235
Aligned: 5 rows
Threshold Bit Score: 572.897
Threshold Setting Gi: 499898262
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015898230   5 YLDCNASTPIDPAVFDAMRPWLVNDFGNSSSRTHEFGLKAKRAVALARKQIASAFGVDQEEVVFTSGATESNNLAILGLA 84  Acidobacterium ...
WP_011329739   4 YLDMNATAPVLKEVADLVRKMFLDEYGNAGSRTHEFGTNAKKSVEKARKQVAEVVDADKSEVIFTSGATESNNIAILGLR 83  Pseudoalteromon...
WP_010984365   7 YLDVAATTRVDPRVAEVVLHWMTEDFGNAGSRTHEYGARAKKAVQQARSYLADTVGAKTEEVIFTSGATESNNIALLGLA 86  Streptomyces av...
WP_011198591   6 YLDNSATTQLLPEVKEVMLPYLLEEFGNPSSKYYGLAQNAKDAVETARKHVAQLLGCETDEVIFTSGATESNNFILKGIA 85  Bacillus cereus
WP_011578996   6 YLDHNATTPIDPAVVAAMEPFLREIFGNPASVEHAHGHAAGLAVDRARAQVAEALGAQPKEIVFTGSCTEANNLAILGVA 85  Chelativorans s...
WP_015898230  85 SWGEQTGRKHLITSAMEHSAVLEPIAWLRDNaGFSVTELPASSDGIIDPDDLRRSL-RPDTALVSLMQVNNETGVIQPLR 163 Acidobacterium ...
WP_011329739  84 EFGEQESKKHIITTRIEHKAVLEPIEYLFKN-GFEVSFLEVDESGVVDSAELKNLL-RKDTLLVSIMHVNNETGSIQPII 161 Pseudoalteromon...
WP_010984365  87 PHGERTGKKHIITSAIEHKAVLEPLLHLAETrGFTVDVLEPGASGRITVEQVMEHV-RPDTLAVSLMHVNNETGVIQPVA 165 Streptomyces av...
WP_011198591  86 HYHKDKG-NHIITSKVEHPSIIETCKFLEAN-GYTVTYLDVDQYGRINLEELTKAIqQEKTLLVSIMWGNNELGSLNQIN 163 Bacillus cereus
WP_011578996  86 RAHPNK--KHIVTTAIEHPAILEPARALERD-GWRVTYAPVDEAGRVSVDAIADAI-TDETTLVSVMAANNEVGTLQPIR 161 Chelativorans s...
WP_015898230 164 ELAIVLTDHPAYFHVDAAQGFGKEFTEISARR-IDLISCTGHKIYGPQGIGALVVKR-THERPIPLKPLTFGGGHERGLR 241 Acidobacterium ...
WP_011329739 162 DICDVLELHEAFLHIDAAQSFGKLSDDLKCKR-IDLISVSGHKVYAPKGVGALVMRK-RGFMKPPLKPIMFGGGQEKGLR 239 Pseudoalteromon...
WP_010984365 166 ELAERLRSTPTYLHVDAAQGYGKIAGDLTAP--IDLISISGHKIGAPKGVGALITRR-RGWDKAPLEPIMFGGGQERKLR 242 Streptomyces av...
WP_011198591 164 EIAKICKENEIFFHTDATQVVGKIQFSLSDIDgINFLSCSSHKFHGPKGIGVTMIGKdNLGLPIQITPLLHGGGQERDLR 243 Bacillus cereus
WP_011578996 162 AIGELCEARGVLFHSDLAQVVAYGTVDVERDH-IHLASLSAHKAYGPKGIGALYIRS-R-KPKARVAPIFFGGGQERGLR 238 Chelativorans s...
WP_015898230 242 PGTLPTHLIVGFGSAASLAVADHKARESKNRSFRKQLFEGLDG---LPLTTHGApnLVIPHVTNLSIDGVSSEAAMVALR 318 Acidobacterium ...
WP_011329739 240 PGTLAVPLIAGFGLACEIAQKNSTAWQKHAQSLKDDLIAALNT---LDAQYNGE--NTSPFVLNFSVPGINSEAAMVMLK 314 Pseudoalteromon...
WP_010984365 243 PGTLPVPLIMGLHEAARIFHESRDNWEREARAMREQILEALGK---TRFRVNGDqaHTVPHILNVSFDQLNAEALIVRLK 319 Streptomyces av...
WP_011198591 244 SGTLPVHNIVGMGKAAEIAYLNLEQNIYKLEQLENKLADILKTkfqNHIEFNNDiqDKIPGILSVIFKGVNNETLVRTLA 323 Bacillus cereus
WP_011578996 239 PGTLNTAAIVGMGEALAIARRCAQADGVRLRAMCNLFRDRLQTs-lPGVKLNGHpaERLANNLSFSIEGVEPLALIRNLR 317 Chelativorans s...
WP_015898230 319 QYIAISNGSACSSAKYEPSHVLRAMGLSNEQLDGAMRFSW 358 Acidobacterium capsulatum
WP_011329739 315 GIAAVSNGSACTSSSYTPSHVLTAMQLDEKRIAGAIRVSW 354 Pseudoalteromonas haloplanktis
WP_010984365 320 DQVAIATGSACTSASYTPSHVLQAMGLPDDVAANGLRFSW 359 Streptomyces avermitilis
WP_011198591 324 PVAAVSTGSACSSSK--PSHVLQAIGLSMDDLRSTIRFSL 361 Bacillus cereus
WP_011578996 318 ADLSFSAASACATDKIETSHVLKAMFGDTGRARTAFRIAP 357 Chelativorans sp. BNC1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap