Conserved Protein Domain Family
OH-pyruv-isom

?
TIGR03234: OH-pyruv-isom 
hydroxypyruvate isomerase
This enzyme interconverts tartronate semi-aldehyde (TSA, aka 2-hydroxy 3-oxopropionate) and hydroxypyruvate. The E. coli enzyme has been characterized and found to be specific for TSA, contain no cofactors, and have a rather high Km for hydroxypyruvate of 12.5 mM. The gene is ofter found in association with glyoxalate carboligase (which produces TSA), but has been shown to have no effect on growth on glyoxalate when knocked out. This is consistent with the fact that the gene for tartronate semialdehyde reductase (glxR) is also associated and may have primary responsibility for the catabolism of TSA.
Statistics
?
PSSM-Id: 163190
View PSSM: TIGR03234
Aligned: 10 rows
Threshold Bit Score: 361.655
Threshold Setting Gi: 490070546
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011289042   3 KFAANLSFLFTDLPFHDRFQRAAATGFQGVEYLFPY-------DWPAHEVADWLKAADVEQVLFNLPPGDWAAGERGLAC 75  Dechloromonas a...
WP_000943544   3 RFSANLSMLFGEYDFLARFEKAAQCGFRGVEFMFPY-------DYDIEELKHVLASNKLEHTLHNLPAGDWAAGERGIAC 75  Enterobacteriaceae
WP_003087181   3 RFCANLSMLFTEVDFLERFDAAAKAGFAGVEYLFPY-------DVEAEAIKARLEANGLEQVLFNLPAGDWAKGERGIAC 75  Pseudomonas
WP_011394557   3 KFAANLSMLFVDVPMEERFSAAAQAGFTGVEIQFPY-------AWDKALLSARKQSAGVSVVLHNLPAGDWDAGERGIAC 75  Hahella chejuensis
WP_011588516   3 RFAANLSMLFTELPFPERFAAAADAGFKGVEYLFPY-------DWPAQQLAQWLADNGLTQVLFNLPAGDWQAGERGIAC 75  Alcanivorax bor...
WP_011525953   3 KFAANLTMLFQEKPFLERFAAARQAGFDAVEYLFPY-------PFSPEELRAQLQGHGLKQVLFNLPAGNWEAGERGIAV 75  Deinococcus geo...
WP_011461642   7 RLVANLSFLFNDLPMMERFKATKEAGLKRVEFMFPY-------DLDLAELKQELAAHELEMVLFNLPAGDWGAGERGIAL 79  Desulfitobacter...
GAJ59125      56 KFAVNVSTIFTEAPFLARFAKAKQHGFSHVECQFPY-------SVAPEAIADELEQLELSLVLLNLPAGDWEKGERGLAI 128 Geobacillus the...
WP_003601388   3 RFAANLSLLFTERSLLDRFAAARAAGFAAVEMQFPY-------AETKEALARRLAETGLLLVLHNLPPGDWAAGERGIAI 75  Methylobacteriu...
WP_003972721   7 RFNVNLSILFTELPLLERPAAAAAAGFTAVELWWPWidsptpeQSELDALKSAIEDAGVQLTGLNFYAGQLPGPDRGALS 86  Streptomyces
WP_011289042  76 LPHRQGE-FAEGVELALNYAILLDC----ERVHCMAGLRPGGISEAELAATYIANLQFAADRFATVGATVMIEPINSRiD 150 Dechloromonas a...
WP_000943544  76 IPGREEE-FRDGVAAAIRYARALGN----KKINCLVGKTPAGFSSEQIHATLVENLRYAANMLMKEDILLLIEPINHF-D 149 Enterobacteriaceae
WP_003087181  76 HPDRVQE-FREGVDKAIAYARVLGN----RQVNCLAGIRPQGHDCASVEKTFVDNLRYAADKLEAAGIRLVMEMINTL-D 149 Pseudomonas
WP_011394557  76 IPGREKE-FREGVALAIAYAKALGS----PRLNCLAGIKPAAVSDEQAWFTLIENLRYAAHKLDEQGIVLTLEAINSL-D 149 Hahella chejuensis
WP_011588516  76 LPDRIAA-FREDVFMAMEYAQALDC----QQVNCLAGLKPDELSSEVAFTTLVENLRFAADLFDAQGLTLTLEAINSRvD 150 Alcanivorax bor...
WP_011525953  76 LQGRQEE-FRQGVTRALTYVEALRNdgppPLVNCLVGKLPAGADAEEARRVLVENLRYAAAELKKVGVTLLVEPINPH-D 153 Deinococcus geo...
WP_011461642  80 DPSRQEE-FKEGVAQAVALAQALHV----KQINCLVGKVREDQSPEEQRATLIANVRYAAKQLQQIGVKLLLEPLNRF-D 153 Desulfitobacter...
GAJ59125     129 FSDRHDE-FRRALEEGVRYALALGV----PNLHCMAGVLPRDLPRERAKETYMRRIDEAAATLAVHGLTLTIEPINPF-D 202 Geobacillus the...
WP_003601388  76 LPDRVSE-FREGVARAIDYAGALGC----RQINCLAGLIPAGIERARLLATLTENLAYAADALGREGLRLLIEPINTR-D 149 Methylobacteriu...
WP_003972721  87 IPGEESErFRANIDVAADFARSLGC----TALNALYGNRVEGVDPAEQDRLALENLVLAARAADRIGAVLLVEALNKP-E 161 Streptomyces
WP_011289042 151 MPGYWLDDVNKALRLIESI----GRSNVKLQLDLYHAQIIQGDLARTIEENIEHIGHVQIADNPGRHEPGTGEINYPFLF 226 Dechloromonas a...
WP_000943544 150 IPGFHLTGTRQALKLIDDV----GCCNLKIQYDIYHMQRMEGELTNTMTQWADKIGHLQIADNPHRGEPGTGEINYDYLF 225 Enterobacteriaceae
WP_003087181 150 IPGFYLQNTRQALEIRDKV----GSANLFLQYDIYHMQIMEGDLARTLENQLAAINHVQLADNPGRHEPGTGEINYRFLF 225 Pseudomonas
WP_011394557 150 VPGFLISSTDSALRAIQLS----GVKNIEYQYDIYHMQVMEGDLVRTIKHHLDTIGHIQFADNPGRHQPGTGEINFAYVF 225 Hahella chejuensis
WP_011588516 151 MPGFLVDTSATAMAVIEAV----GRENIRLQYDLYHMQIMEGDLCRSLSQLCPHIGHIQFADNPGRNEPGSGEIHFDTVF 226 Alcanivorax bor...
WP_011525953 154 IPGFFLRTPDQAAALIDEV----GADNLKIQYDLYHQQRTEGQLLDTFRRLQGRIAHVQLADVPGRHQPGTGEINYPFVL 229 Deinococcus geo...
WP_011461642 154 APGFYLNTTEDVLKVIDEA----GSENVFLQYDVYHAAREGEDLLQILREKLPHIAHIQVADNPGRHQPGTGEIDYHAFF 229 Desulfitobacter...
GAJ59125     203 MPGYFLTDIEEAAAIIRDL----GRTNVKLQYDVYHMARLGRNVTAMFADYAPLIAHVQFADAPGRHEPGTGELPYREIF 278 Geobacillus the...
WP_003601388 150 MPGFFLNRLADAAAVIEAV----GSENLFIQADLYHMAMMGEDLASELAAHRARIAHVQIADAPGRHEPGTGRIDVSAAF 225 Methylobacteriu...
WP_003972721 162 SPRYPLVSAPAAIAVVDRVneatGLGNAKFLMDLYHLSMNGEDLPQVIDAYAAKTGHVQIADNPGRGAPGTGSLPLEDLL 241 Streptomyces
WP_011289042 227 NLLDRLGYAGWVGCEYKPLTT-TEAGLGWLP 256 Dechloromonas aromatica
WP_000943544 226 KVIENSDYNGWVGCEYKPQTT-TEAGLRWMD 255 Enterobacteriaceae
WP_003087181 226 EHLDRIGYQGWIGCEYKPATT-TEAGLGWMK 255 Pseudomonas
WP_011394557 226 SQLDEMGYQGWVSAEYIPLGN-TRETLEWLH 255 Hahella chejuensis
WP_011588516 227 AHIDSLDYAGWVSAEYRPLTD-TATSLGWFN 256 Alcanivorax borkumensis
WP_011525953 230 AALDRDGYGGYVGLEYIPAGD-TVSSLAWLK 259 Deinococcus geothermalis
WP_011461642 230 KVLTEVGYPYAVSMEYVPQPD-TVASLEWIK 259 Desulfitobacterium hafniense
GAJ59125     279 AFLQEHGYNGAIGLEYIPSGK-SSESFVWYD 308 Geobacillus thermoleovorans B23
WP_003601388 226 ATLDRLGYDGFIGCEYLPASG-TEAGLGWMS 255 Methylobacterium extorquens
WP_003972721 242 DRLAKAGYDGWVGLEYKPGDDpSAQSFSWLP 272 Streptomyces
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap