Conserved Protein Domain Family

TIGR03233: DNA_S_dndB 
DNA sulfur modification protein DndB
This model describes the DndB protein encoded by an operon associated with a sulfur-containing modification to DNA. The operon is sporadically distributed in bacteria, much like some restriction enzyme operons. DndB is described as a putative ATPase. [DNA metabolism, Restriction/modification]
PSSM-Id: 163189
Aligned: 6 rows
Threshold Bit Score: 613.304
Created: 9-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_011332373 328 AMI-G-GRMAKNSQNITLTCNQIKFSLGLGLTPEEQVIEDAF 367 Pseudomonas fluorescens
WP_015898229 319 AML-A-GAIAKTNSSQLLMANHIQKKLGLELTRTVKDMKGAN 358 Acidobacterium capsulatum
WP_010984364 335 AIV-G-GRVSKSHQNVTLTVNYLRKHLGLELSPEERRVEDAY 374 Streptomyces avermitilis
WP_011329738 317 CVI-N-NSMTNNRKAAELTCIQIKSHLNIPLTDKEQLVEKTF 356 Pseudoalteromonas haloplanktis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap