Conserved Protein Domain Family
DNA_S_dndB

?
TIGR03233: DNA_S_dndB 
DNA sulfur modification protein DndB
This model describes the DndB protein encoded by an operon associated with a sulfur-containing modification to DNA. The operon is sporadically distributed in bacteria, much like some restriction enzyme operons. DndB is described as a putative ATPase. [DNA metabolism, Restriction/modification]
Statistics
?
PSSM-Id: 163189
View PSSM: TIGR03233
Aligned: 6 rows
Threshold Bit Score: 613.304
Threshold Setting Gi: 499649004
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011332373  10 PFSYTFPAIRGVQAGREFYVSMCPLRLLAKLFVFDNEELMPELRAQRSINRTRVPEIARYILSNTDSYTFSAITASIDGK 89  Pseudomonas flu...
WP_015898229   4 AFEYRFPAIRGIQSNREYYISMCPLRLIPKLFIFDEAELRPELRAQRTLNRARIPEISDYIVKNRDSYTFSAITASVDGG 83  Acidobacterium ...
WP_010984364  20 GFEYTFPAIRGVQAGREFYASMCPLRLIPKIFLFDEDDLSAELRAQRVLNKGRLPALARYILDNPDDYVFSALTASVDGD 99  Streptomyces av...
WP_000384435   4 GFSYNFPALRGKQGGKEYFVVMCPLRLIPKIFLFDEEEIPAEHRAQRILNKIRIPEITNYIIENQNDYVFSSLTASIDGD 83  Bacillus cereus
WP_011400707   8 EYTHKFPAVRGMQAGRPCYIAMCPMRLIPKLFVFDEDVVPPELRAQRRLNESRVPDITHYLVENPDSYTLSAITASIDGS 87  Hahella chejuensis
WP_011329738   5 VSGTSFPAIKGMQAKTEYYIVMCPLKRLSKIFTLDEGQLPVNQRAQRIINEERIPDIANYILDSRDNYVFSALTACIDGL 84  Pseudoalteromon...
WP_011332373  90 VGFEPVGTNDTTHfRMGTLTVDMDAKFVVNDGQHRRAAIEQALEERPELGDETIAVVFFHDRGLERCQQMFADLNRHAVK 169 Pseudomonas flu...
WP_015898229  84 IQFEPMSQDVSMT-RLGLLRVEMNAKFIINDGQHRRAAIENALKADPSLGDESIAVVFFHDRGLARSQQMFADLNMHAAR 162 Acidobacterium ...
WP_010984364 100 MAFECQGAEGSAH-RTGQLRIPMDARFLINDGQHRRAAIELALKEKPDLGDETIAVVFFHDTGLSRSQQMFADLNRHAVR 178 Streptomyces av...
WP_000384435  84 IEFQPFSSDQSFQ-DLGQLRISLDSKFLINDGQHRRAAIEEAIKLSPELGHETISVVFYHDQGLRNSQQIFSDLNRHAVN 162 Bacillus cereus
WP_011400707  88 VIFEPVADTGPAI-NLGMLSIGMDTQILVNDGQHRRKAIEQAVKEAHELGHDNIPVLFFVDEGLTRSQQMFADLNKHAVR 166 Hahella chejuensis
WP_011329738  85 SEFIGIGESKHEQ-KIGTLVIDEDAEIYITDGQHRNAAILEALKADPTLADETISVVFFTNKSLEERQRIFKDLNLYPVK 163 Pseudoalteromon...
WP_011332373 170 PSPSLSVLYDHRNAAASVAKHLGLTSRVFRNLVESERSSLSKRSRKLFTLSALHFAILEMLSAKDLEDFT-WA-SKRCNE 247 Pseudomonas flu...
WP_015898229 163 PSRSLGLLYEQRDDLALITKEAIPRTKIFRDMVEFERSTLAERSRKLFTLSAIYGANKVLTENRPFENRT-EV-LQFLID 240 Acidobacterium ...
WP_010984364 179 PARSIGVLYDHRDLNAQITRALTERSAIFKGFVEMEKSTLSARSRKLFTLSALYYGNQSLL--QGLDLKQdEA-IKLTQS 255 Streptomyces av...
WP_000384435 163 TTSSIGILYDHRDKLALVTKEIVEENELLSRYTDKEKVNLSKNSPKILALNHIFNTNLRLLGKTKGDLIT-EKeEQFLKE 241 Bacillus cereus
WP_011400707 167 PSDSLSTLYDHRDGGSKLARYVFECVPCFKSLTDLESSSLSKRSSKLFTLSSLKQASKALLGKRGKDPIS-EPeMQLACE 245 Hahella chejuensis
WP_011329738 164 TDSSLSITYDDKPD-AILSKTIIFRSEQFTKLVHMEKSNLGPRSKKLISHSAVNKASKYLLGTITKNNYE-SL-IPVAFE 240 Pseudoalteromon...
WP_011332373 248 FWEVVGEQIPEWTHVRESRMTAGEVRQDFIHSHAIVLQALGRVGKFVYRTADGrpDLKSALKNLRDIDWSRTNSATWEGR 327 Pseudomonas flu...
WP_015898229 241 FWDTVGSHMKEWQLIQQGRQTSGELRRDFIHAHSIALHALGIVGRDLVQQFPK--NWKGKLRKLRDIDWSRSNTKDWEGR 318 Acidobacterium ...
WP_010984364 256 FWEAVDTALPEWAMVRGKQLSAQEMRRDFIHSHGIALHALGRVGNALLRESVKeaAWKRRLVPLTDVDWTRGN-IDWEGR 334 Streptomyces av...
WP_000384435 242 FWNILCDTIVEWNLVYKKELNPRELRMHYIVGHGVFIESVGLVGKYVFENHPK--DWKKYISLLADIDYSRSNSSDWLGR 319 Bacillus cereus
WP_011400707 246 YWEAVCSNMPHWHDALERNISTSDLREQYIHAHGIGLGALGEAGSDLLRQFPN--NWKDKLTHLSEIDWSRSNIKQWRGR 323 Hahella chejuensis
WP_011329738 241 FWHEVLKNMPAWQLVCDDKASGGELRDESIHAHAVTFHALGLLGFHLLNNDPK---WQSKLKGLQKINWSR-NSINWSGR 316 Pseudoalteromon...
WP_011332373 328 AMI-G-GRMAKNSQNITLTCNQIKFSLGLGLTPEEQVIEDAF 367 Pseudomonas fluorescens
WP_015898229 319 AML-A-GAIAKTNSSQLLMANHIQKKLGLELTRTVKDMKGAN 358 Acidobacterium capsulatum
WP_010984364 335 AIV-G-GRVSKSHQNVTLTVNYLRKHLGLELSPEERRVEDAY 374 Streptomyces avermitilis
WP_000384435 320 AFNtN-GRIQKTKETVTLTANKLKEKLGLPLTEGEQKIEEKF 360 Bacillus cereus
WP_011400707 324 AMD-NhGKISKTRSSTVLTANIIRHALGVSLGAEQQHIEDQL 364 Hahella chejuensis
WP_011329738 317 CVI-N-NSMTNNRKAAELTCIQIKSHLNIPLTDKEQLVEKTF 356 Pseudoalteromonas haloplanktis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap