3E99


Conserved Protein Domain Family
benzo_1_2_benB

?
TIGR03232: benzo_1_2_benB 
Click on image for an interactive view with Cn3D
benzoate 1,2-dioxygenase, small subunit
Benzoate 1,2-dioxygenase (EC 1.14.12.10) belongs to the larger family of aromatic ring-hydroxylating dioxygenases. Members of this family should all act on benzoate, but several have additional known activities on various benozate analogs. Some members actually may be named more suitably according to such alternate an activity, such as 2-chlorobenzoate 1,2-dioxygenase (1.14.12.13).
Statistics
?
PSSM-Id: 132276
View PSSM: TIGR03232
Aligned: 7 rows
Threshold Bit Score: 289.79
Threshold Setting Gi: 499388393
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3E99_A        10 IQAFLYRESRLLDDKAWDAWLDCYRADAVFWXPSWDDADALVTDPQREISLIYYPNRQGLEDRVFRIKTERSSAT-VPDT 88  Burkholderia ma...
WP_011300522   9 VQAFLYREARLLDDEQWDEWLTCYHAEARFWMPCWDDDGQLITDPEREISLIFYPSRQGLEDRIFRIKTERSSAT-IPDT 87  Cupriavidus pin...
WP_011326275 543 IQAFLYRESRLLDDKAWDAWLDCYRADAVFWMPSWDDADALVTDPQREISLIYYPNRQGLEDRVFRIKTERSSAT-VPDT 621 Burkholderia ps...
WP_004925491  15 ISQFLYSEARFLDDEQWDDWLECYAPQASFWMPAWDDNDQLTENPQTEISLIYYPDRQGLEDRVFRIKTERSSAT-MPDT 93  Acinetobacter
WP_010954049   7 VRDFLYREARYLDDAQWDQWLELYASDASFWMPSWDDDDTLTEDPQSEISLIWYGNRGGLEDRVFRIKTERSSAT-VPDT 85  Pseudomonas putida
WP_011288507   8 VCAFLYREARLLDESDWDSWLALYDENCTFWMPAWDDDGNLTEDPQSEISLIWYGRRAGLEDRIFRIRTERSSAT-IPDT 86  Dechloromonas a...
WP_011075860  17 IEDFLYYEARLLDDRRFEDWLQCYREDAEFWMPAWDDNGELTEDPQSEISLIFYPNRGGLEDRVFRIRTERSSATsLPEP 96  Corynebacterium...
3E99_A        89 RTSHNIANVERESADGDVHTVRFNWHTLSYRYKTVSSYFGXSRYAIDFSGDAPKIVSKYVVLKNDYINQLIDIYHI 164 Burkholderia mallei...
WP_011300522  88 RTCHNLSNVEIVERDGDKLTVRFNWHTLAHRYQTNYSYFGMSRYVIDFAGAHPQILDKYVVLKNDYINQVIDIYHI 163 Cupriavidus pinatub...
WP_011326275 622 RTSHNIANVERESADGDVHTVRFNWHTLSYRYKTVSSYFGMSRYAIDFSGDAPKIVSKYVVLKNDYINQLIDIYHI 697 Burkholderia pseudo...
WP_004925491  94 RTAHNISNIEVESRDGLQITVRFNWNTLSFRYKNSYSYFGMSRYVIDFSGEQPKILSKYVMLKNDYINQVIDIYHI 169 Acinetobacter
WP_010954049  86 RTSHNISNIEIVEQGEDNCQVRFNWHTLSFRYKTTDSYFGTSFYTLDLRGEQPLIKAKKVVLKNDYVRQVIDIYHI 161 Pseudomonas putida
WP_011288507  87 RTSHNITNVEILEQGNGVIKLRFNWHTMSVRYNHTDHFCGTSFYTLDTSGASPIIKDKKIVLKTDYIRHVIDVYHI 162 Dechloromonas aroma...
WP_011075860  97 RTVHNISNVEILEQRDGEVDIRFNWITNYFRYNNTDMYYGNTFLTIDTSGESMKITKKKVVLQNDYIHHVIDIYHV 172 Corynebacterium eff...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap