Conserved Protein Domain Family
lipo_lipase

?
TIGR03230: lipo_lipase 
lipoprotein lipase
Members of this protein family are lipoprotein lipase (EC 3.1.1.34), a eukaryotic triacylglycerol lipase active in plasma and similar to pancreatic and hepatic triacylglycerol lipases (EC 3.1.1.3). It is also called clearing factor. It cleaves chylomicron and VLDL triacylglycerols; it also has phospholipase A-1 activity.
Statistics
?
PSSM-Id: 132274
View PSSM: TIGR03230
Aligned: 4 rows
Threshold Bit Score: 912.355
Threshold Setting Gi: 108743278
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAE95413   60 DYTDIVSKFSLRTADIPDDDMCYIVAGSPDTIEDCEFNPETQTFIVIHGWTVTGMFESWVPKLVSALYEREPSANVIVVD 139 red seabream
NP_571202  52 DFTDIESKFSFRTLEEPEDDLCYIVPGQPQSIKDCNFNTETKTFIVIHGWTVTGMFESWVPKLVTALYEREPSANVIVVD 131 zebrafish
P11602     33 NFEGIESKFSLRTPAEPDEDVCYLVPGQMDSLAQCNFNHTSKTFVVIHGWTVTGMYESWVPKLVDALYKREPDSNVIVVD 112 chicken
P06858     33 DFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVD 112 human
BAE95413  140 WLTRANQHYPTSAAYTKLVGRDVAKFVTWIQKELHLPWDRIHLLGYSLGAHVAGIAGDLTEHKISRITGLDPAGPTFENA 219 red seabream
NP_571202 132 WLSRAQQHYPTSASYTKLVGKDVAKFVNWLQAEIDYPWEKLHLLGYSLGAHVAGIAGLLTKHKVNRITGMDPAGPTFEYA 211 zebrafish
P11602    113 WLVRAQQHYPVSAAYTKLVGKDVAMFIDWMEEKFNYPLNNVHLLGYSLGAHAAGIAGSLTKKKVNRITGLDPAGPTFEYA 192 chicken
P06858    113 WLSRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYA 192 human
BAE95413  220 DNQNTLSPDDAQFVDVLHTNTRGSPDRSIGIQRPVGHIDIYPNGGTFQPGCDIQSTLLGIAlegIKGLQNMDQLVKCSHE 299 red seabream
NP_571202 212 DSLSTLSPDDANFVDVLHTNTRGSPDRSIGIQRPVGHIDIYPNGGTFQPGCDLQNTMLMVA---TTGLRNMDQIVKCSHE 288 zebrafish
P11602    193 DAPIRLSPDDADFVDVLHTYTRGSPDRSIGIQKPVGHIDIYPNGGGFQPGCNLGEALRLIA---EKGFSDVDQLVKCSHE 269 chicken
P06858    193 EAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIA---ERGLGDVDQLVKCSHE 269 human
BAE95413  300 RSIHLFIDSLLNTEQQSMAYRCNSKEAFNKGLCLSCRKNRCNKLGYNINKVRRTRSTKMYLKTREMMPYKVFHYQVKVHF 379 red seabream
NP_571202 289 RSIHLFIDSLVNQDHESMAFRCSSRDSFNKGMCLSCRKNRCNKVGYAVNKIRTRRSSKMYMKTREMMPYKVFHYQVKVHF 368 zebrafish
P11602    270 RSIHLFIDSLLYEEKPSMAYRCNTKEAFEKGLCLSCRKNRCNNLGYKVNRVRTKRNTKMYLKTRAQMPYKVFHYQVKIHF 349 chicken
P06858    270 RSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHF 349 human
BAE95413  380 FSKDPLSFTDQPMKISLYGTHGEKEDIPHVLPVMKGNTTLSFLITTDVDIGDLMIVKLRWEKDTIISWSdWWGSSKFHIR 459 red seabream
NP_571202 369 FGKTQLSYTDQPMKISLYGIHGEKENIPYIMPTLNTNSTVSFLLTTDADIGELLMVKLLWEKDTLISWP-WWNSDTFHIR 447 zebrafish
P11602    350 FGKTNVTKVDQPFLISLYGTLDESENIPFTLPEVSSNKTFSFLIYTEVDIGDLLMLKLQWEKDTFFSWSdWWTPFAFTIQ 429 chicken
P06858    350 SGTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSdWWSSPGFAIQ 429 human
BAE95413  460 KLRIKSGETQSKVIFSAKEGEFVYLVRGGEDGVFVKSKEDNLSRK 504 red seabream
NP_571202 448 KLRIKSGETQSKIIFSAKESEFSYLSRGGEAAVFVKDKEAQSSRK 492 zebrafish
P11602    430 RVRVKSGETQKKVVFCSRDGS-SRLGKGEEAAIFVKCLEQPVSRK 473 chicken
P06858    430 KIRVKAGETQKKVIFCSREKV-SHLQKGKAPAVFVKCHDKSLNKK 473 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap