Conserved Protein Domain Family

TIGR03229: benzo_1_2_benA 
benzoate 1,2-dioxygenase, large subunit
Benzoate 1,2-dioxygenase (EC belongs to the larger family of aromatic ring-hydroxylating dioxygenases. Members of this family all act on benzoate, but may have additional activities on various benozate analogs. This model describes the large subunit. Between the trusted and noise cutoffs are similar enzymes, likely to act on benzoate but perhaps best identified according to some other activity, such as 2-chlorobenzoate 1,2-dioxygenase ( [Energy metabolism, Other]
PSSM-Id: 132273
Aligned: 5 rows
Threshold Bit Score: 935.035
Threshold Setting Gi: 493820795
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_011300521 419 RIGLNPVM-SGVRTEDEGLYTVQHRYWLDVMKKAM 452 Cupriavidus pinatubonensis
WP_014591011 406 EIELEPLL-SGVRTEDEGLFVLQHKYWQDTMIQAL 439 Pseudomonas putida
WP_011288506 406 KIGLKPIL-SGVKTEDEGLYVAQHTYWLEQMHRAH 439 Dechloromonas aromatica
WP_006768309 414 GLGMNEVLsSGARTEDEGLYPVQHHYWHDLMQRAV 448 Corynebacterium efficiens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap