Conserved Protein Domain Family
benzo_1_2_benA

?
TIGR03229: benzo_1_2_benA 
benzoate 1,2-dioxygenase, large subunit
Benzoate 1,2-dioxygenase (EC 1.14.12.10) belongs to the larger family of aromatic ring-hydroxylating dioxygenases. Members of this family all act on benzoate, but may have additional activities on various benozate analogs. This model describes the large subunit. Between the trusted and noise cutoffs are similar enzymes, likely to act on benzoate but perhaps best identified according to some other activity, such as 2-chlorobenzoate 1,2-dioxygenase (1.14.12.13). [Energy metabolism, Other]
Statistics
?
PSSM-Id: 132273
View PSSM: TIGR03229
Aligned: 5 rows
Threshold Bit Score: 935.035
Threshold Setting Gi: 493820795
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011300521  19 LDQFLVENHETGDYRLHRSAFTDEALFELEMKHIFEGNWIYLAHESQIPNNNDYYTTHMGRQPVFIARNRQGELNAFINA 98  Cupriavidus pin...
WP_004925496  15 IDELLVDNTETGEFKLHRSVFTDQALFDLEMKYIFEGNWVYLAHESQIPNNNDYYTTYIGRQPILIARNRNGELNAMINA 94  Acinetobacter
WP_014591011   8 LNAMLEDDREKGIYRCKREMFTDPRLFDLEMKHIFEGNWIYLAHESQIPEKNDFLTLTMGRQPIFIARNKDGELNAFLNA 87  Pseudomonas putida
WP_011288506   7 LDSLIQKDKEKGLFRCKREMFTSQELFDLEMKYLFEGNWIYLAHESQVGKINDYYTTKMGRQPVFITRNKDNQLNCFINA 86  Dechloromonas a...
WP_006768309  15 LDRALEDRPEEGIVRVNRNIFTDPEIFELEMRHIFEGNWIYLAHESQIPNPGDYFTTYMGRQPIMITRSKDGELNCLINA 94  Corynebacterium...
WP_011300521  99 CTHRGAMLCRHKRGNKATYTCPFHGWTFNNSGKLLKVKDPEGAGYPECFNKEGSHDLKKVARFENYRGFLFGSLNDDVLP 178 Cupriavidus pin...
WP_004925496  95 CSHRGAQLCRHKRGNKTTYTCPFHGWTFNNSGKLLKVKDPSDAGYSDCFNQDGSHDLKKVARFESYKGFLFGSLNPDVPS 174 Acinetobacter
WP_014591011  88 CSHRGAMLCRHKRGNRSSYTCPFHGWTFNNSGKLLKVKDPSNAGYPDSFNCDGSHDLTKVARFESYRGFLFGSLNADVKP 167 Pseudomonas putida
WP_011288506  87 CAHRGATLARFKHGNKGTYTCPFHGWTFNNSGKLLKIKDPEGTGYPATFNCDGSHDLKKIARFESYKGFLFGSLNADVLP 166 Dechloromonas a...
WP_006768309  95 CSHRGAMLCRRKTDNRTTLTCPFHGWTFSNDGALLKVKDEKDGAYPENFNKDGSHDLRRVPKFESYRGFLFGSLNPDVVS 174 Corynebacterium...
WP_011300521 179 LKDFLGDAARIIDMIADQSPDGLEVLRGSSTYTYEGNWKLQAENGADGYHVSAVHWNYAATTNHRKQQNEReDKIRAMDA 258 Cupriavidus pin...
WP_004925496 175 LQEFLGETTKIIDMIVGQSDQGLEVLRGVSTYTYEGNWKLTAENGADGYHVSAVHWNYAATTQHRKEKQAG-DTIRAMSA 253 Acinetobacter
WP_014591011 168 LVEHLGESAKIIDMIVDQSPEGLEVLRGASSYIYEGNWKLTAENGADGYHVSSVHWNYAATQNQRKQREAG-DEIKTMSA 246 Pseudomonas putida
WP_011288506 167 LEEYLGESKKIIDMIVDQSADGLEVLRGASTYVYEGNWKLQAENGADGYHVTATHWNYAATQAQRKSRDAG-DDINAMSA 245 Dechloromonas a...
WP_006768309 175 LEEHLGDTRTVIDMLVDQSPDGLEVLRGSSTYTYDGNWKLQTENGADGYHVSSTHWNYAATTSRRGTGESA-NETKAMDA 253 Corynebacterium...
WP_011300521 259 GKWGQQGGGFYAFDHGHMLLWTRWANPEDRPNFARRAEFAERCGEETADWMIQNSRNLCLYPNVYLMDQFGSQIRLLRPL 338 Cupriavidus pin...
WP_004925496 254 GSWGKHGGGSYGFEHGHMLLWTQWGNPEDRPNFPKAAEYTEKFGAAMSKWMIERSRNLCLYPNVYLMDQFGSQIRVLRPI 333 Acinetobacter
WP_014591011 247 GAWAKQGGGFYSFDHGHLLLWTRWANPEDRPAYERRDQLAADFGQARADWMIENSRNLCLYPNVYLMDQFSSQIRVARPI 326 Pseudomonas putida
WP_011288506 246 GGWAKNGGGSYSFENGHLLLWTRWDNPEDRPLMEQRDRLVGEFGEAKADWMIKNSRNLCLYPNVFLMDQFSSQIRVFRPL 325 Dechloromonas a...
WP_006768309 254 GTWGKQGGGYFSYPNGHMLLWMWWGNPEDRPLYDRRDELKEKFGEEKGEFMVGASRNLCLYPNVYIMDQFSSQIRHFRPI 333 Corynebacterium...
WP_011300521 339 SVDKTEVTIYCIAPKGEPDDARARRIRQYEDFFNVSGMATPDDLEEFRACQQGYNGSALAWNDMCRGSKHWIEGPDEAAQ 418 Cupriavidus pin...
WP_004925496 334 SVNKTEVTIYCIAPVGEAPEARARRIRQYEDFFNASGMATPDDLEEFRACQAGYAGIELEWNDMCRGSKHWIYGPDDAAN 413 Acinetobacter
WP_014591011 327 SVNKTEITIYCIAPKGESADARAKRIRQYEDFFNVSGMATPDDLEEFRSCQTGYGG-GTGWNDMSRGAKHWVEGADEAAK 405 Pseudomonas putida
WP_011288506 326 APDRTEVTIYCIAPKGESPEARAKRIRQYEDFFNASGMATPDDLEEFRACQEGFNGAYLEWNDMSRGAEHWVEGPDAEAD 405 Dechloromonas a...
WP_006768309 334 SVDKTEVTIYCIAPKGESAQARANRIRQYEDFFNATGMATPDDLEEFRSCQKTYLATGFPWNDMTRGLGHQIEGPNEVAK 413 Corynebacterium...
WP_011300521 419 RIGLNPVM-SGVRTEDEGLYTVQHRYWLDVMKKAM 452 Cupriavidus pinatubonensis
WP_004925496 414 EIGLKPAI-SGIKTEDEGLYLAQHQYWLKSMKQAI 447 Acinetobacter
WP_014591011 406 EIELEPLL-SGVRTEDEGLFVLQHKYWQDTMIQAL 439 Pseudomonas putida
WP_011288506 406 KIGLKPIL-SGVKTEDEGLYVAQHTYWLEQMHRAH 439 Dechloromonas aromatica
WP_006768309 414 GLGMNEVLsSGARTEDEGLYPVQHHYWHDLMQRAV 448 Corynebacterium efficiens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap