Conserved Protein Domain Family
anthran_1_2_A

?
TIGR03228: anthran_1_2_A 
anthranilate 1,2-dioxygenase, large subunit
Anthranilate (2-aminobenzoate) is an intermediate of tryptophan (Trp) biosynthesis and degradation. Members of this family are the large subunit of anthranilate 1,2-dioxygenase, which acts in Trp degradation by converting anthranilate to catechol. Closely related paralogs typically are the benzoate 1,2-dioxygenase large subunit, among the larger set of ring-hydroxylating dioxygenases. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 132272
View PSSM: TIGR03228
Aligned: 3 rows
Threshold Bit Score: 959.44
Threshold Setting Gi: 491067314
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011059123  14 IGSCLDFRPADGVFRIARDMFTEPELFDLEMELIFEKNWIYACHESELPNNHDFITMRAGRQPMIITRDGEGRLNALVNA 93  fluorescent pse...
WP_003113310  15 VGGCLDFRPEEGIFRIARDMFTEPELFDLEMELIFEKNWIYACHESELARPHDFVTLRAGRQPLIVTRDGNGQLHALVNA 94  Pseudomonas
WP_004928945  13 VQGCIDFRPNDGVYRIARDMFTEPELFELEMELIFEKVWIYACHESEIPNNNDFVTVQIGRQPMIVSRDGKGELHAMVNA 92  Acinetobacter
WP_011059123  94 CQHRGTTLTRVGKGNQSTFTCPFHAWCYKSDGRLVKVKAPGEYDEGFDKATRGLKKARIESYKGFVFISLDVAADNSLED 173 fluorescent pse...
WP_003113310  95 CQHRGATLVRVGKGNQSTFTCPFHAWCYKNDGRLVKVKAPGEYPEGFDKATRGLKKARIQSYRGFVFVSLDVAGEDDLVD 174 Pseudomonas
WP_004928945  93 CEHRGATLTRVAKGNQSVFTCPFHAWCYKSDGRLVKVKAPGEYCEDFDKSSRGLKQGRIASYRGFVFVSLDTQATDSLED 172 Acinetobacter
WP_011059123 174 FLGDARIFFDMMVAQSPDGELEVLPGKSAYTYDGNWKLQNENGLDGYHVSTVHYNYVATVQHRQQVNADSGaGSSATLDY 253 fluorescent pse...
WP_003113310 175 FLGDARVFLDMLVAQSPSGELEVLPGTSTYTYEGNWKLQNENGLDGYHVSTVHYNYVATVQHRQQVEAERG-GVAATLDY 253 Pseudomonas
WP_004928945 173 FLGDAKVFLDLMVDQSPTGELEVLQGKSAYTFAGNWKLQNENGLDGYHVSTVHYNYVSTVQHRQQVNAAKG-DELDTLDY 251 Acinetobacter
WP_011059123 254 SKLGAGDASTDDGWFAFENGHSVLFSEMPNPAVRSGYASIMPRLVAEHGQAKAEWMMHRLRNLNIYPSLFFLDQISSQLR 333 fluorescent pse...
WP_003113310 254 SKLGAGDAATDDGWFSFANGHSVLFSEMPNPAVRPGYASVMPRLVAEYGQARAEWMMHRLRNLNLYPSLFVIDQISSQLR 333 Pseudomonas
WP_004928945 252 SKLGAGDSETDDGWFSFKNGHSVLFSDMPNPTVRPGYNTVMPYLVEKFGEKRAEWAMHRLRNLNLYPSLFFMDQISSQLR 331 Acinetobacter
WP_011059123 334 IIRPIAWNKTEIISQCIGVKGESDADRENRIRQFEDFFNVSGMGTPDDLVEFREAQRGFQGRLERWSDISRGRQHWVSGP 413 fluorescent pse...
WP_003113310 334 IVRPLAWNRTEIVSQCIGVKGESDADRENRIRQFEDFFNVSGMGTPDDLVEFREAQRGFQARLERWSDISRGHGKWLEGA 413 Pseudomonas
WP_004928945 332 IIRPVAWNKTEVISQCIGVKGESSEARRNRIRQFEDFFNVSGLGTPDDLVEFREQQKGFQGRIERWSDISRGYHQWTYGP 411 Acinetobacter
WP_011059123 414 TANSENLGIQPAMTGTEITHEGLYVNQHRNWQKFLLDGL 452 fluorescent pseudomonads
WP_003113310 414 TPNSQALGIAPLLTGTEITHEGLYVNQHAHWRRFLLDGL 452 Pseudomonas
WP_004928945 412 TQNSQDLGIEPVITGREFTHEGLYVNQHGQWQRLILDGL 450 Acinetobacter
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap