Conserved Protein Domain Family
PhnS

?
TIGR03227: PhnS 
2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate binding protein
This ABC transporter periplasmic substrate binding protein component is found in a region of the salmonella typhimurium LT2 genome responsible for the catabolism of 2-aminoethylphosphonate via the phnWX pathway (GenProp0238). The protein contains a match to pfam01547 for the "Bacterial extracellular solute-binding protein" domain.
Statistics
?
PSSM-Id: 132271
View PSSM: TIGR03227
Aligned: 2 rows
Threshold Bit Score: 570.512
Threshold Setting Gi: 486183755
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004194640   1 MTYTNFPRggaWRRFALAAgaaallqgaaAQAQAAAVVL-YTADGLEN----LYRDVLPAFEKQEGVKVNIVTAGSGEVV 75  pseudomallei group
WP_001539309   1 MKLSRLAL---LSVFALAS----------APSWAESVVTvYSIDGLHDgdnsWYQVQFDAFTKATGITVRYVEGGGGVVV 67  Salmonella ente...
WP_004194640  76 NRANVEKGSPKADVIVTLPPFIQQAGQFGLLQPYRSVNYKNVPAiakaEDGSWATFVNNYFSFAINPSVVKSQPKTFADL 155 pseudomallei group
WP_001539309  68 ERLAKERTNPQADVLVTAPPFIQRAAAEKLLANFNTDAASAIPD----ANNLYSPLVKNYLSFIYNSKLLKTAPASWQDL 143 Salmonella ente...
WP_004194640 156 LHPDYSGKLAYSNPATAGDGMAVIILTSALMG-EDKAFDYLAKLERSVKFHTKGTGYLNVLLSRNEIAVANGDLQMDLDD 234 pseudomallei group
WP_001539309 144 LDAKFKNKLQYSTPGQAADGMAVMLQAFHSFGsKDAGFAYLGKLQANNVGPSASTGKLTALVNKGEIYVANGDLQMNLAQ 223 Salmonella ente...
WP_004194640 235 AEHGGlSIKPIFVAAKAGEPpTTFQLPYAIGLVKGGPNQDAGRKLIDYLMSADVQAKVPDM-FGIPGRTDVPLSGKNGEA 313 pseudomallei group
WP_001539309 224 MERNP-NVKIFWPANDKGER-SALAIPYVIGLVQGAPQSENGKKLINFLLSKEAQTRVSELsWGMPVRSDVTPSDEHYKA 301 Salmonella ente...
WP_004194640 314 VKRAIAGVKLIPVDWDAVMAKKPVWTERWKKevigdsgkqteVVKPK 360 pseudomallei group
WP_001539309 302 ATAALEGVQSWQPNWDDVAVSLSADISRWHK-----------VTESE 337 Salmonella enterica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap