Conserved Protein Domain Family
benzo_boxA

?
TIGR03224: benzo_boxA 
benzoyl-CoA oxygenase/reductase, BoxA protein
Members of this protein family are BoxA, the A component of the BoxAB benzoyl-CoA oxygenase/reductase. This oxygen-requiring enzyme acts in an aerobic pathway of benzoate catabolism via coenzyme A ligation. BoxA is a homodimeric iron-sulphur-flavoprotein and acts as an NADPH-dependent reductase for BoxB. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 132268
View PSSM: TIGR03224
Aligned: 4 rows
Threshold Bit Score: 822.974
Threshold Setting Gi: 499835261
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011482565   8 VIKQHLIDPEICIRCNTCEAICPVQAITHDSRNYVVDAEKCNLCMACISPCPTGSIDNWRTMPRIKAYSLTEQLGWDELP 87  Polaromonas sp....
WP_011494012   9 VLRQHLIDPEICIRCNTCEETCPIDAITHDDNNYVVKADVCNGCMACVSPCPTGAIDNWRTVLKADAYSIDEQFSWDELP 88  Burkholderia xe...
WP_011237395   9 IAKQHLIDPEICIRCNTCEETCPIDAITHDNLNYVVNFDICNGCLACVPPCPTGAIDSWRNVERAKPYSLEEQFKWDVLP 88  Aromatoleum aro...
WP_011515995   6 IIKQHLIDPEICIRCNTCEDTCPIDAITHDDRNYVVKADVCNACNACLSPCPTGAIDNWRTMLKGQAYTIEAQLTWDELP 85  Cupriavidus met...
WP_011482565  88 PELTPEELAAEgvvPGAMPEIEPVApslPAAVSGETafNSAQYGATMPPWSAAHGYTNLYGAKAAekfITATVVGNVRVT 167 Polaromonas sp....
WP_011494012  89 AQNTTANAALD---ATAQANGDDET---GETASGIE--VDAARGSTVPPWSAAKPYVNLYTHKAP---TTATVVGNYRLT 157 Burkholderia xe...
WP_011237395  89 DTTELDNVDA----PFAVARPDDELpaeVQHITEVA--TAGQGGPALAPWSASHPYVNLYAPTRP---ITATVTGNYRLT 159 Aromatoleum aro...
WP_011515995  86 EEVPLPEAEIE---AAAAAGQVIEEasrGSKSVAVQevEASRHTSSRAPWSAAHPYVNLHGVREP---VTATVAGNHRLT 159 Cupriavidus met...
WP_011482565 168 EVGKEYDTHHIVLDFGSMPFPVLEGQSIGILPPGTDEASKPHYARQYSIASPRNGERPGYNNVSLTIKRVLQDHQGNAVR 247 Polaromonas sp....
WP_011494012 158 DELADSDIHHIVLDFGTLPFPVLEGQSIGILPPGTTKDGKPHHARQYSLASPRDGERPRYNNVSLTVKRVTRDYQDNATD 237 Burkholderia xe...
WP_011237395 160 DADASSDIHHVVLDFGSTPFPVLEGQSIGIIPPGTDDKGRPHLLRMYSVASPRNGERPHYNNLALTVKRVTEDHEGKAAR 239 Aromatoleum aro...
WP_011515995 160 AEDASSDIHHIVLDFGNHFFPVLEGQAIGIVPPGTDASGKPHYIRMYSVASPRDGERPGYNNLALTVKRVDTDHDGNPVR 239 Cupriavidus met...
WP_011482565 248 GVGSNYMCDLQIGDKVQVIGPFGTSFLMPNHPRSNIVMICTGTGSAPMRAMTEWRRRLRQSGkfEGGKLMLFFGARTKEE 327 Polaromonas sp....
WP_011494012 238 GVCSNYLCDLKKGDKVTVIGPFGSTFLMPNHPDSHLLMICTGTGSAPMRAMTEYRRRRRLKG--ATGKLMLFFGARTKEE 315 Burkholderia xe...
WP_011237395 240 GVASNYVCDLKKGDKVQVTGPYGSTYLMPNHPASSIMMICTGTGSAPMRAMTERRRRRIAQN--EGGELVLFFGARAPSE 317 Aromatoleum aro...
WP_011515995 240 GVASNFLCDLAKGDPVQVVGPFGSTFLMPNHREASVMMICTGTGSAPMRAMTERMRRNMDH---FSGRRLLFFGARNRRE 316 Cupriavidus met...
WP_011482565 328 LPYFGPLQTLPKDFIDINFAFSRTLEQPKRYVQDAMRERAADLGVLLKDPNTYFYVCGLKSMEEGVVLALRDVAQQAGLS 407 Polaromonas sp....
WP_011494012 316 LPYFGPLTNLPKDFIDTNLAFSRTPGQPKRYVQDAMRERAVDIAQLLKSDGTYIYVCGLKGMEDGVLQALQEIAERNGLD 395 Burkholderia xe...
WP_011237395 318 LPYFGPLQKLPKDFIDINFAFSRVPGEPKKYVQDSIRERADKVFRMLNDDNCYIYICGLKGMESGVLEAFRDICRANGAD 397 Aromatoleum aro...
WP_011515995 317 LPYFGPLLKLPKDFLDIHFAFSRDPEVPRRYVQDAIREASAQVAALLADPHGHIYICGLKGMEEGVLDAFAEVCATSGQS 396 Cupriavidus met...
WP_011482565 408 WETVGAALKQEGRLHLETY 426 Polaromonas sp. JS666
WP_011494012 396 WATLWPRLRREGRLHLETY 414 Burkholderia xenovorans
WP_011237395 398 WEALQPKLLANARFHVETY 416 Aromatoleum aromaticum
WP_011515995 397 WQDIEPRLRAEGRLHIETY 415 Cupriavidus metallidurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap