Conserved Protein Domain Family
catechol_dmpE

?
TIGR03220: catechol_dmpE 
2-oxopent-4-enoate hydratase
Members of this protein family are 2-oxopent-4-enoate hydratase, which is also called 2-hydroxypent-2,4-dienoate hydratase. It is closely related to another gene found in the same operon, 4-oxalocrotonate decarboxylase, with which it interacts closely.
Statistics
?
PSSM-Id: 132264
View PSSM: TIGR03220
Aligned: 10 rows
Threshold Bit Score: 465.353
Threshold Setting Gi: 499674328
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ABB72211       5 LINELGDELYQAMVNREAISPLTERGFAISIDDAYHISLRMLERRLAAGEQIIGKKIGVTSKAVQNMLGVYQPDFGYLTD 84  Pseudomonas sp....
BAA09692       5 LIETLGDELYAALCSRTVVDPLTSRYPDITIDNAYHIQQRMISRRLQAGERIVGKKIGVTSAAVMNMLGVSQPDFGYMLD 84  Pseudomonas flu...
AAP92396       5 KIEQYGEELYQAFVSRRAVAPLLSREPDISIEDAYRIQEQFVARRLAAGEKIIGKKIGATSKPVQEFLGVYQPDFGMLTS 84  Pseudomonas alk...
WP_029310117   5 QITQLGDALYQALTTRTVLDPLTERHPDMTIEDAYHIQQRMIERRVQAGETIIGKKIGVTSAAVMNMLGVYQPDFGYMLD 84  Cupriavidus met...
WP_011289510   5 QITQLGDELYEALVAGKTVSPLTSRGFDITIEDAYHIQQQMLSRRLAKGERVIGKKIGVTSKPVMNLLGVHQPDFGYLLD 84  Dechloromonas a...
WP_011077885   5 QIDSLGNELYEALIKRTPLSPLSSRGFDISIEDAYQIQQRMTALRIQNGEKIIGRKIGVTSKAVMNMLGVHQPDFGTLTD 84  Pseudomonas
WP_011301799   5 KTQHYGDALYESLLTRKPLEPLTDREPDITIEDAYQIQLRMIGRRLEAGETVIGKKIGVTSRVVMDMLGVDQPDFGHLLS 84  Cupriavidus pin...
WP_011356551   5 LITALGDRLYDAMASRTPVAPLTSQHEDLSVDDAYRIQQRFVQRRLDAGETVIGKKIGVTSKAVMDMLGVYQPDFGYLLS 84  Burkholderia lata
WP_011297676   5 LITSLSNELHHALVTRLPVPPLSGRGLSLGINDAYRIQQGFIAHRLAAGDRITGKKIGVTSQAVQQMLDVHQPDFGILLQ 84  Cupriavidus pin...
WP_011355062   5 LHTTLGDELYAAWHARAPVAPLSSRPRRLSLDDAYRIQQRFIERRVEHGEAVVGKKIGVTSQAVQDMLNVRQPDFGILLS 84  Burkholderia lata
ABB72211      85 AMVFNSGEAMPISQLLmQPQAEGEIAFILKKDLIGPGVTNADVLAATECVMPCFEIVDSRIRDWKIKIEDTVADNASCGL 164 Pseudomonas sp....
BAA09692      85 GMIYGDGAAIDAATLI-QPKAEGEIAFVLKKDLMGPGVSAADVLAATEGVMACFEIVDSRITDWKIHIQDTVADNASCGV 163 Pseudomonas flu...
AAP92396      85 GMVFAEGDTIDLGQMI-QPKAEAELAFVLKHDLKGPGITAMDVIRATDYVLPCFEIVDSRISNWQIKIQDTVADNASCGV 163 Pseudomonas alk...
WP_029310117  85 GMIYNEGQSIEIGTLI-QPKAEGEIAFILKKDLMGPGVTNVDVLAATECVMPCFEIVDSRIRDWKIKIQDTVADNASCGV 163 Cupriavidus met...
WP_011289510  85 GMVYNEGESIEMSSLI-QPKAEGEIAFLLKKDLKGPGVTAADVLAATEGVMACFEIVDSRITDWKIKIQDTVADNASCGV 163 Dechloromonas a...
WP_011077885  85 GMVCSSAEPIRMENLI-QPKAEGEIAFVMKKDLMGPGVTAADVLAATEGVMACFEIVDSRIKNWEIKIQDTVADNASCGV 163 Pseudomonas
WP_011301799  85 GMVFNEGEPVDTGKMI-APKAEAEVAFVLSRDLCGPGLTAADVLRATDCVMPCFEIVDSRIRDWKIRIQDTVADNASCGV 163 Cupriavidus pin...
WP_011356551  85 GMVYGEGECIPLDTLI-QPKAEGEIAFVLKRDLLGPGVTNAMVLAATECVMPCFEIVDSRIRDWKIRIGDTVADNASCGV 163 Burkholderia lata
WP_011297676  85 SMHYAEGLPIPTDTLI-QPRAEGEIAFFLRRDLRGPGVTRDDVLDATEAVAACFEIVDSRIRDWRIRIEDTVADNASCGV 163 Cupriavidus pin...
WP_011355062  85 GMHYAAGEAIAADSLI-APRAEGEIAFILARDLRGPGIDRTDVIAATAAVAPCFEIVDSRIRDWAIRIEDTVADNASCGV 163 Burkholderia lata
ABB72211     165 FVLGDTAVSPRQVDLVTCGMLVEKNGQLLSTGAGAAALGSPVNCVAWLANTLGRFGIPLKAGEVILSGSLVPLEPVKAGD 244 Pseudomonas sp....
BAA09692     164 FVLGDRMVDPRGLDLRTSGMVLEKNGETVVTGAGAATMNSPVNAVVWLANTLGKLGIPLKAGEVILSGALGAMVPVKAGD 243 Pseudomonas flu...
AAP92396     164 FVLGKTKGDPRKLDITLAGMVLEKNGELFSTGVGAAVQGSPANAVAWLANTLGELGIPFKAGEVILSGSQSALVPVTDGD 243 Pseudomonas alk...
WP_029310117 164 FVLGDHAVDPRKLDLTLCGMVMERNGEIIATGCGAAALGSPVNAVAWLANTLGRLGIALKAGEVILSGALAAMFPAKAGD 243 Cupriavidus met...
WP_011289510 164 FVLGDQLVDISNVDLGLCGMVLEKNGEIVVTGAGAATMGHPVNAMVWLANTLGKLGITLKAGDIVLSGAMGAMVPVVKGD 243 Dechloromonas a...
WP_011077885 164 FVLGDRLVDPASIDLSLCGMVLEKNGEIVVTGAGAATMASPVNAMVWLANTLGRLGIPLKAGEVVLSGALGAMVPVQAGD 243 Pseudomonas
WP_011301799 164 FTLGGTRRSPRDLDLALAGMVLEKNGEIVSTSCGASVQGSPVNAVAWLANTLGRFGIALKAGDVILSGSQSPLVPVKPGD 243 Cupriavidus pin...
WP_011356551 164 FVLGDQAVSTRRVDLATCGMVLEKNGDVIGTGAGAAALGSPVNAVAWLANTLGRLGIPLKAGEVILSGALAAMAPAGPGD 243 Burkholderia lata
WP_011297676 164 YVLGDERISPHALNLAACAMTLEKNGECVATGSGSAALGHPADAVAWLANTLGSFGIPLLAGETILSGSLAALIPVQAGD 243 Cupriavidus pin...
WP_011355062 164 YVLGDARVDPRTLDLAACEMTIEKNGEPVAQGRGDAALGHPADAVAWLANTLAAYDVPLLAGEIVLSGSLAKLIPVTAGD 243 Burkholderia lata
ABB72211     245 FMRVEIGGIGSASVRF 260 Pseudomonas sp. KB35B
BAA09692     244 NLRVSIGGIGNCSVRF 259 Pseudomonas fluorescens
AAP92396     244 ELVCSVGGLGSCRVKF 259 Pseudomonas alkylphenolia
WP_029310117 244 SFRVSIGGLGGCSVRF 259 Cupriavidus metallidurans
WP_011289510 244 NLRMTIGGIGGCSVRF 259 Dechloromonas aromatica
WP_011077885 244 NLRVAIGGIGGCTVRF 259 Pseudomonas
WP_011301799 244 SLYCSVGGLGGTSVRF 259 Cupriavidus pinatubonensis
WP_011356551 244 NFRVSIGGIGACSVRF 259 Burkholderia lata
WP_011297676 244 RLSMQISGIGSCTAQF 259 Cupriavidus pinatubonensis
WP_011355062 244 ALSMHISGIGSCDVRF 259 Burkholderia lata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap