Conserved Protein Domain Family
catechol_dmpH

?
TIGR03218: catechol_dmpH 
4-oxalocrotonate decarboxylase
Members of this protein family are 4-oxalocrotonate decarboxylase. Note that this protein, as characterized (indirectly) in Pseudomonas sp. strain CF600, was inactive except when coexpressed with DmpE, 2-oxopent-4-enoate hydratase, a homologous protein from the same operon. Both of these enzymes are active in the degradation of catechol, a common intermediate in the degradation of aromatic compounds such as benzoate, toluene, phenol, dimethylphenol (dmp), salicylate, etc. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 132262
View PSSM: TIGR03218
Aligned: 8 rows
Threshold Bit Score: 442.674
Threshold Setting Gi: 47496799
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P49156         1 MNRTLTRDQVLALAEHIENAELDVHDIPKVTNDYPDMTFADAYDVQWEIRRRKEARGNKVVGLKMGLTSWAKMAQMGVET 80  Pseudomonas sp....
AAZ08072       1 MNRTLNREQVLALAEHIENAELQGHEIHKVTNEYPEMNFADAYDIQWEIRRRKEERGKKIVGLKMGLTSWAKMGQMGVET 80  Pseudomonas pse...
BAA23561       5 YENKLTKAQIEELAAHCEKAELEAYEITKITDDYPQMTYKDAFDIQWEIRRRKEGRGHKIVGMKMGLTSWAKMAQMGVEK 84  Acinetobacter s...
BAA88505       1 --MALYPATIEQLAEHLENCELQAHDTLKITDAHPDMDWDDAYAIQAAILARKLARGARVVGLKAGLTSHAKMKQMGVTD 78  Comamonas testo...
BAD19052       3 RDLTLSREDIVRLCERVEGAQTRAYAIPKLTNEYPQMTIADGYAVQNELRRRFIAQGHKQVGWKAGLTSKAKMQQMGVSV 82  Pseudomonas putida
WP_011301800   1 --MTLNRETIEALAAHVESAQLAVRDITKITDEYPDLDWADAYDIQDEIRRRKESRGLRTVGLKAGLTSFAKMKQMGVET 78  Cupriavidus pin...
WP_011356548   1 --MNLTTDIVESLAEHLDGCMRDARDTPKITDRHPEMDWDDAYAVQDAIRRRQLGRGARIVGYKAGLTSHAKMRQMGVDT 78  Burkholderia lata
WP_011288501   1 --MNLNQQTIAQLAEHLENAELQAHEVIKITEAHPDMDWDDAYAIQYEILRRKLARGAKVVGLKAGLTSHGKMKQMGVST 78  Dechloromonas a...
P49156        81 PIYGFLVDYFSVPDGGVVDTSKLIHPKIEAEISFVTKAPLHGPGCHIGQVLAATDFVIPTVEVIDSRYENFKFDLISVVA 160 Pseudomonas sp....
AAZ08072      81 AIYGFFGDYFSVADGGRVECSKVIYPKIEAEIAVVTKAPLLWAAWHIGDVITAIDYVIPTVEVIDSRYENFKFDLISVVA 160 Pseudomonas pse...
BAA23561      85 PCYGFLADYFSVPEGGEIKHDELIHPKIEAELAFVLKHELKGPGVHIGDVLRATDFVMPAVEVIDSRYKDFKFDLKSVIA 164 Acinetobacter s...
BAA88505      79 PVFGFLVDYFSVPDGGTVKTSELIHPKVEPEIAFVLKHALKGPGCHIGAVLAATDFVMPGIEVIDSRYRDFKFDLKSVVA 158 Comamonas testo...
BAD19052      83 PSIGFLTDRMARPESSAISTSDLVHPRVECEVAFVMKADLQGPGCTAADVLAATDYVLPAVEIIDSRFSGFKFDLASVIA 162 Pseudomonas putida
WP_011301800  79 PVFGFVSEDMARPDGGEIRMSELIHPKVEAEICIVTKAPLRGPGCHVGSVLAAIDFVVPAVEIIDSRYRDFKFDLKSVIA 158 Cupriavidus pin...
WP_011356548  79 PVFGFLTDIYDLPDGGECDTSALIHPKVEPEIAFVTKAELKGPGCHIGAVLAATDFVIAGIEVIDSRYRDFKFDLKSVVA 158 Burkholderia lata
WP_011288501  79 PVFGWLVDYFSVPDGGEIKHSELIHPKVEPEIVFVTKKALKGPGCHIGGVLAATDFVMPGIEIIDSRYKDFKFDLKSVIA 158 Dechloromonas a...
P49156       161 DNASSTRFITGGQMANVADLDLRTLGVVMEKNGEVVELGAGAAVLGHPASSVAMLANLLAERGEHIPAGSFIMTGGITAA 240 Pseudomonas sp....
AAZ08072     161 DNASSTRYITGSRMANLEEVDLRTLGVVMEKNGEVVELGAGAAVLGHSLSKRCMLANLLAERDEHIPAGTFIMTCGITAA 240 Pseudomonas pse...
BAA23561     165 DNSSSSRFVTGGRMADIADVDLKNIGVVMEINGEVVQTGAGAAVLGHPAASVAMLANMMAERGESLPTGSFIMIGAITAA 244 Acinetobacter s...
BAA88505     159 DNTSAARFVVGGQPVRPDALDLRTVGLVLEKNGQPVAMGAGAAVLGHPAAAIAMLANHLGRRGQEIPAGSLILSGGATEA 238 Comamonas testo...
BAD19052     163 DNGSSARFVGGGRARYVEDLDLPTLGVVMEKNGEIVAMGAAAAVMGHPAEAIAMLVNILAEMDEILPAGSFVMSGGITEA 242 Pseudomonas putida
WP_011301800 159 DNTSAARFVVGGRARAPEDLDLRTLGVVLEKNGRAVAMAAGAAVLGHPAAAVAMMANHLGARGQEIPAGTFIMTGGVTEA 238 Cupriavidus pin...
WP_011356548 159 DNTSAARFVAGGRPLAVDGVDLRTLGVVLEKNGLPVAFGAGAAVLGHPAAAVAMLANHLGARGESIPAGSVILSGGITEA 238 Burkholderia lata
WP_011288501 159 DNCSSTRFVLGGQATPVAGLDLRTLGVVMEKNGEPVAIGAGAAVLGHPAAAIAALANHLGARGEEIPAGTMILSGGVTEA 238 Dechloromonas a...
P49156       241 VPVAPGDNITVRYQGLCSVSARF 263 Pseudomonas sp. CF600
AAZ08072     241 VAVAPGDNITVRYQGLGSVSARF 263 Pseudomonas pseudoalcaligenes KF707
BAA23561     245 VQVDKGDAFTVRYQGLGTLSGKF 267 Acinetobacter sp. YAA
BAA88505     239 MAVTAGDHVCLRVQGMGSTSIQF 261 Comamonas testosteroni
BAD19052     243 IAVKPGDSIVARFQELGSVSMRF 265 Pseudomonas putida
WP_011301800 239 IAVAAGDSVCVRFQKLGSVSMRF 261 Cupriavidus pinatubonensis
WP_011356548 239 VAVAAGDSVTLRVQDVGSIGLRF 261 Burkholderia lata
WP_011288501 239 IAVAPGDHVTLRIQSLGTVSTRF 261 Dechloromonas aromatica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap