Conserved Protein Domain Family
OH_muco_semi_DH

?
TIGR03216: OH_muco_semi_DH 
2-hydroxymuconic semialdehyde dehydrogenase
Members of this protein family are 2-hydroxymuconic semialdehyde dehydrogenase. Many aromatic compounds are catabolized by way of the catechol, via the meta-cleavage pathway, to pyruvate and acetyl-CoA. This enzyme performs the second of seven steps in that pathway for catechol degradation. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 132260
View PSSM: TIGR03216
Aligned: 12 rows
Threshold Bit Score: 882.522
Threshold Setting Gi: 499669599
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P19059         4 IKHFINGAFVgsA--SG--RTFEDVNPANGQVIARVHEAGRAEVDAAVQAARAALKGPWGKMSVSERAEILHRVADGITA 79  Pseudomonas sp....
BAA88501       4 IQNFINGAYV--S--TG--RSFDKHSPLTGKVIAKVHEAGRNEVDAAVTAARTALNGPWGRMSVAERVEKLYAVADGINR 77  Comamonas testo...
CAB06615      13 ILNFIDGSYRegS--EG--KSFSNVNPATGAEIGVVHEASQADVADAVAAAKAALTGPWGKMTTAERVKLITAVATEIER 88  Sphingomonas sp.
WP_011289512   4 ILNFINGEFV--A--TG--KQFEKRTPLDNSLIGMVHEAGKAEVDAAVKAAHDALEGPWGKMTVVERTDILNKVADEITR 77  Dechloromonas a...
WP_011485982  19 LRHYVDGAFV--G--SE--VTFSNINPVDGTLIAEVCEANASTVDQAVRAAQAALKGPWGRLSVQERAAVLHKVADGILA 92  Polaromonas sp....
WP_011289530   7 IHHFINGEFT--A--SPdpRYFDKRSPVDGRVIAHIAEAGQADVDAAVTAARAALKGEWGKLSTDQRVDLLYGVANEITR 82  Dechloromonas a...
WP_011301797   4 FRNFINGEFV--A--TN--KTFENRAPVDNRVIGRVHEAGQAEVDAAVAAARAALHGDWGRMPVARRVELLHAVADEINR 77  Cupriavidus pin...
WP_011004187   2 IQNFINGAYR--EgrAG--KRFRDLDPCTGRLVAEVSEAGKEDVDDAVQAARAALNGPWGKLTLAQRCDLLYAVADEIDR 77  Ralstonia solan...
WP_011521492   4 LHSYIGGRFV--P--GK--RGFADINPADGSVAATVTEASAEMVDEAVAAARKALHGEWGKLGARGRATVLYKIAEGIEK 77  Candidatus Kori...
WP_011489338   4 YKNFINGRFV--E--SD--KRFAGINPATGVRFADVHEATREMVDEAVSAGHRAVRG-WGSASVSDRADMLYRIADEIDR 76  Burkholderiaceae
WP_011301606   8 YRNYVDGRFV--E--SA--KGFPNISPVNGAVIGTVCEAGADLVDRAVRAARAALAGPWGRTTPAERARVLQAVADGIEK 81  Cupriavidus pin...
WP_011350333  15 LRHYIDGAFV--E--TA--RTFADTSPVDGREIARVCEADEASVDAAVRAARAAQAAGWRDTTPAQRADWLHRIADGIQA 88  Burkholderia lata
P19059        80 RFDEFLEAECLDTGKPKSLASHIDIPRGAANFKVFADLLKNVATEAFEMATPDGSGAINYAVRRPKGVIGVISPWNLPLL 159 Pseudomonas sp....
BAA88501      78 RFEEFLAAECADTGKPRSVASHIDIPRGAANFKIFADVVKNVPTEFFEMATPDGRGAINYGHRGPVGVVGVICPWNLPLL 157 Comamonas testo...
CAB06615      89 RADDFLAAEVADTGKPRHVASHIDIPRGAANFRMFADVVSTMPGESFNTPTPDGGQAFNYTVRKPKGVVAVVCPWNFPLL 168 Sphingomonas sp.
WP_011289512  78 RFDEFLEAECADTGKPKSLASHIDIPRGAANFKIFADVIKNAPTEFFEMATPDGKGALNYAIRRPVGVVGVVCPWNLPLL 157 Dechloromonas a...
WP_011485982  93 RFEEFVEAEVADTGRPVHQARTLDIARAIANFRTFADLAKTANTDLFEMATADGAGALNYTVRKPLGVIGVISPWNLPLL 172 Polaromonas sp....
WP_011289530  83 RFDDFVAAEMADTGQPSHVQTHVFIPRGAANFKVFADVIKNVAAESFRMATPDGKGALNYAIRNPKGVIGVISPWNAPFL 162 Dechloromonas a...
WP_011301797  78 RFDDFLEAELADTGKPRSLAAHIDIPRGAANFKVFADIVKNAPTESFEMTTPDGGTAISYALRAPLGVVAVVCPWNLPLL 157 Cupriavidus pin...
WP_011004187  78 RKEDFLAAEVADTGKPRALASHLDIPRGAANFRVFADAVRNVATECFTGTAPDGKPSLNYALRRPKGVIAVVCPWNLPLL 157 Ralstonia solan...
WP_011521492  78 RFDCFVQAEVADTGKPLSLASRLDVPRAAANFRVFADVIKIAGLEAFETELPDGRRALNYTVRKPIGVVGIVTPWNLPLL 157 Candidatus Kori...
WP_011489338  77 RADDFLTAEVSDTGKPVSLASKLDIPRGAANFRIFADILKTAPLDTFRTDLPGGSHAINYAVRKPLGVVGIISPWNLPLL 156 Burkholderiaceae
WP_011301606  82 RFDAFVAAEVADTGRPEHQARTLDIRRGVQNFRTFAELAGQAGGECFEMRAADG-DVFSYTVRKPHGVVAIISPWNLPML 160 Cupriavidus pin...
WP_011350333  89 RFDDFVAAEVADTGRPLAQARTLDIARGIANFRTFADLVRTAGDDCFESQTADGAQYLNYVTRKPLGVVGIISPWNLPLL 168 Burkholderia lata
P19059       160 LMTWKVGPALACGNTVVVKPSEETPLTTALLGEVMQAAGVPAGVYNVVHGFGPDSAGAFLTEHPDVNAITFTGETRTGEA 239 Pseudomonas sp....
BAA88501     158 LMTWKVGPALACGNTVVVKPSEESPQTAALLGEVMNEAGIPPGVYNVVHGFGPDSAGEFVTSHPGVDAITFTGETRTGEA 237 Comamonas testo...
CAB06615     169 LMTWKVGPALACGNTVVVKPSEETPRTAALLGEVMNAVGMPKGVYNVVHGFGPGSAGEFLTSNPDVDAITFTGETGTGQA 248 Sphingomonas sp.
WP_011289512 158 LMTWKVGPALACGNTVVVKPSEETPSTATLLGEVMNACGVPKGVYNVVHGFGPNSAGEFLTTNQNVNAITFTGETRTGAA 237 Dechloromonas a...
WP_011485982 173 LFTWKVAPALACGNTVVAKPSEESPSSATLLAEVMHDAGVPPGVFNLIHGFGKDSAGEFLTRHPGISALTFTGESKTGST 252 Polaromonas sp....
WP_011289530 163 LMTWKVGPALACGNTVVVKPSEETPLTATLLGEVMNSVGIPKGVYNVINGFGPDSAGAYLTQHPGVDAITFTGETRTGTA 242 Dechloromonas a...
WP_011301797 158 LMTWKVGPALACGNTVIVKPSEETPATATLLGEVMEKVGVPKGVYNVLHGFGPGSAGEFLTRHPGVNGITFTGETRTGEA 237 Cupriavidus pin...
WP_011004187 158 LMTWKVGPALACGNTVVVKPSEETPATAALLGEVMNAVGVPAGVYNVVHGFGPDSAGEFLTRHPDVDAITFTGETRTGAA 237 Ralstonia solan...
WP_011521492 158 LLTWKVAPALACGNAVVVKPSEETPATATLLAEVMQEAGVPDGVYNVVHGFGPNSAGEFLVSHPGVNAVTFTGESQTGAS 237 Candidatus Kori...
WP_011489338 157 LFSWKVAPALACGNAVVAKPSEETPGTATLLAEVMQTVGLPAGAFNLVHGFGPNSAGEFITTHPGINAITFTGESKTGTA 236 Burkholderiaceae
WP_011301606 161 LMTWKVAPALACGNAVVIKPSEETPGSATLLAEVMHEAGVPPGVFNLVHGFGGGSAGEFLSRHPDIDAITFTGESRTGST 240 Cupriavidus pin...
WP_011350333 169 LFTWKVAPALAMGNCVVAKPSEETPGSATLLAEVIDAVGLPRGVFNLVHGHGPAAAGEFLTRHPGIDAITFTGESRTGSA 248 Burkholderia lata
P19059       240 IMRAAAKGVRPVSFELGGKNAGIVFADCDLDKAIEGSMRSVFANGGQVCLGTERLYVERPIFDEFVARLKAGAESLVIGT 319 Pseudomonas sp....
BAA88501     238 IMKAAAKGARPVSLEMGGKNAAIVFADCDFDAAIDGTLRSAFVNSGQVCLGTERVYVERPIYERFVAALKQQIEGWKIGV 317 Comamonas testo...
CAB06615     249 IMQKAATGVRDISFELGGKNPAIVFADADLDKAVEGLSRSVFLNTGQVCLGTERVYVERPIFDAFVARMAAAAQDFKPGV 328 Sphingomonas sp.
WP_011289512 238 IMKAAADGARPVSLEMGGKNPAIVFADANLDVAIEATLRSCFSNCGQVCLGTERVYVERPFFETFVAALKAGAEKLKLGV 317 Dechloromonas a...
WP_011485982 253 IMKSVADGVKEVSFELGGKNAAVVFADTDFDAAVAGVLRSAFTNSGQVCLCSERVYVQRPIFDKFVAALKAGTERLKIGY 332 Polaromonas sp....
WP_011289530 243 IMKAAAEGMRDVSFELGGKNAGIVFADCNFEAAVDGIFRSAFLNTGQVCLGTERVYVERPIFENFVQALKAKVEGVRYGR 322 Dechloromonas a...
WP_011301797 238 IMAAAAKGVRPVSFELGGKNAGIVFADADFDKAVAGIARSAFENCGQVCLGTERVYVQRPIFDRFVQALKEKAESLRIGP 317 Cupriavidus pin...
WP_011004187 238 IIKASADGIKPVSMELGGKNPALVFADADLDAVIAGLKRSVFENTGQVCLGTERVYVERPMFDKVVRALAEIAGTLRPGL 317 Ralstonia solan...
WP_011521492 238 IMRACAPTVKPVSFELGGKNAAVIFADCDFDATIAGMSDAVFLNTGQVCLCAERVYVERRIFDRFVAALTERAKSYDLGW 317 Candidatus Kori...
WP_011489338 237 IMHAAAEGVKPVSFELGGKNAAIIFADCDFDKTVAGMTRAAFLNSGQVCLCSERIFVERPIYDRFVKALAERAKQIKLGD 316 Burkholderiaceae
WP_011301606 241 IMKAVADGVKEVSFELGGKNAAVVFADCDFDQAVAGVTRSSFTNTGQVCLCSERVYVERPIFERFVAAMKARAEAMRIGY 320 Cupriavidus pin...
WP_011350333 249 IMKAVADGVKDISFELGGKNAAVVFADADFDAAVDGIVKSSFTNAGQVCLCSERVYVERPIFERFVAALKTRTEALQVGA 328 Burkholderia lata
P19059       320 PDDPQANFGPLISLQHREKVLSYYQKAVDEGATVVTGGGVPEMPAELAGGAWVQPTIWTGLADGAAVVTEEIFGPCCHIR 399 Pseudomonas sp....
BAA88501     318 PEDDDTKLGPLISKEHQAKVLSYYQLAVQEGATVVTGGGMPDLGAQYADGAWVQPTIWTGLPETARVIKEEIFGPCCHIA 397 Comamonas testo...
CAB06615     329 TGD-RAYLGPLISAEHREKVLGYYRRAVEDGATVVTGGGVPEISGAEAGGFFVEPTLWIDVAHGDTVMREEIFGPCCGIL 407 Sphingomonas sp.
WP_011289512 318 PSDPSANMGPLVSQEHRNKVLSYYKKAVEEGATVVTGGGIPDMPGELANGAWVQPTIWTGLDDNAAVVREEIFGPCTTVM 397 Dechloromonas a...
WP_011485982 333 PHDDGVDIGPLISHGHRDKVLSYYKLAVEEGATVVTGGGVPSFGDARDAGAYVQPTIWTGLTDSARCVTEEIFGPVCHIA 412 Polaromonas sp....
WP_011289530 323 PEDHTSTYGPLISQEHRDKVLSYYKKAVDEGATVVTGGGVPDMPAELAGGSWVQPTIWTGLPETAAVVREEIFGPCCHIR 402 Dechloromonas a...
WP_011301797 318 SDAPGVGLGPLISAEHKAKVMSYYDVARSEGATVVTGGGAPSMPPELAEGHWVQPTIWTGLPESARVIREEIFGPCCHIA 397 Cupriavidus pin...
WP_011004187 318 PGDPHANFGPLISGEHQRKVLGYYALARDEGATVHYGGGVPDMPPDLREGAWIEPTVWTGLPRDSRVLTEEIFGPCCHVE 397 Ralstonia solan...
WP_011521492 318 PMEPATSMGPLISKVHREKVLSYFDLAREEGATVVIGGGVPTFGDGRDSGFYVQPTIFTGLKESARCVKEEIFGPVCHVA 397 Candidatus Kori...
WP_011489338 317 PTDEATCMGPVISAAHRDKVLSYYALAREEGAEFITGGGTPSFGNQLDGGFWVEPTLLAGLPDDARCVTEEIFGPIGHVT 396 Burkholderiaceae
WP_011301606 321 PDEDGVEMGSLISHGHRDKVLSYFALAREEGATVVAGGGVPQFGDARDNGAYVQPTIWTGLPDSARCVQEEVFGPVCHIA 400 Cupriavidus pin...
WP_011350333 329 PDDPATTMGPLISRGHRDKVLSYFRLAVDEGATVVTGGGVPAFGDARDDGAFVQPTIWTGLPDTARCVTEEIFGPVCHVA 408 Burkholderia lata
P19059       400 PFDREEEAVELANSLPYGLAATIWTENTSRAHRVAGQLEAGIVWVNSWFLRDLRTAFGGSKQSGIGREGGVHSLEFYTEL 479 Pseudomonas sp....
BAA88501     398 PFDTEEEVLTKANDNVYGLASAIWTQDLARAHRVAQRMHVGISWVNSWFLRDLRTPFGGAKQSGIGREGGVHSLEFYTEL 477 Comamonas testo...
CAB06615     408 PFDSEDEVIALANDTVYGLCASVWTENLSRGHRVAAAMEVGVCWVNSWFLRDLRTAFGGSGHSGIGREGGVHSLEFYTEI 487 Sphingomonas sp.
WP_011289512 398 PFDSEDEVIKRANNTTYGLAASVFTQDVNRAHRVAGRIEAGLVWVNSWFLRDLRTPFGGAKQSGIGREGGVHSLEFYTEL 477 Dechloromonas a...
WP_011485982 413 PFDNEEEVIARVNDSVYGLACAVWTTNLSRAHRVSRQIHVGLVWVNTWYLRDLRTPFGGVKLSGLGREGGRYSLDFYSDV 492 Polaromonas sp....
WP_011289530 403 PFDSEEEVIELANANDYGLATTIWTENLSRAHRVAERVEVGVTWVNSWFLRDLRTPFGGSKQSGIGREGGVHSLEFYTET 482 Dechloromonas a...
WP_011301797 398 PFDTEEEAIALANATDYGLATTVWTQDLGTAHRMARAIDVGLCWINSWFLRDLRTAFGGAKASGIGREGGVHSLEFYTEL 477 Cupriavidus pin...
WP_011004187 398 PFDSEEEAVRLANGTPYGLATSLYTGDVNRAHRVSAKLKVGVVWVNTWFLRDLRTAFGGSGKSGIGREGGVHSLEFYTEL 477 Ralstonia solan...
WP_011521492 398 PFDSEEEAVALANDTRYGLAASIWTSDLQRAHRVAPQMNAGITWVNCWFLRDLRTPFGGVGLSGIGREGGMHSLNFYSEL 477 Candidatus Kori...
WP_011489338 397 PFDSEAEVIQRANATPYGLAATIWTSNVNKAHRVAQSMNVGVAWVNAWFLRDLRTPFGGSGLSGIGREGGLHSLNFYSEL 476 Burkholderiaceae
WP_011301606 401 PFDSDDEVVARVNDSRYGLAASVWTRDLGRAHRVTRQFDVGIVWVNTWFLRDLRTPFGGTRLSGIGREGGRHSLDFYSST 480 Cupriavidus pin...
WP_011350333 409 PFDSEDEVIRRVNDSAYGLAASVWTTHLARGHRVAKRIETGIVWLNAWFVRDLRTPFGGTKLSGIGREGGRHSLDFYSET 488 Burkholderia lata
P19059       480 KNICVKL 486 Pseudomonas sp. CF600
BAA88501     478 KNVCIKL 484 Comamonas testosteroni
CAB06615     488 TNICVKL 494 Sphingomonas sp.
WP_011289512 478 KNVCIKL 484 Dechloromonas aromatica
WP_011485982 493 ANICIKL 499 Polaromonas sp. JS666
WP_011289530 483 RNVCIKL 489 Dechloromonas aromatica
WP_011301797 478 RNVMVKL 484 Cupriavidus pinatubonensis
WP_011004187 478 SNVCLKL 484 Ralstonia solanacearum
WP_011521492 478 NNICIRT 484 Candidatus Koribacter versatilis
WP_011489338 477 TNVCIHV 483 Burkholderiaceae
WP_011301606 481 TTICVNP 487 Cupriavidus pinatubonensis
WP_011350333 489 TNVCVRV 495 Burkholderia lata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap