Conserved Protein Domain Family
ac_ald_DH_ac

?
TIGR03215: ac_ald_DH_ac 
acetaldehyde dehydrogenase (acetylating)
Members of this protein family are acetaldehyde dehydrogenase (acetylating), EC 1.2.1.10. This enzyme oxidizes acetaldehyde, using NAD(+), and attaches coenzyme A (CoA), yielding acetyl-CoA. It occurs as a late step in the meta-cleavage pathways of a variety of compounds, including catechol, biphenyl, toluene, salicylate, etc.
Statistics
?
PSSM-Id: 132259
View PSSM: TIGR03215
Aligned: 20 rows
Threshold Bit Score: 455.235
Threshold Setting Gi: 497593106
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011288965   4 KLKVAIIGPGNIGTDLMIKIMRhGEHLEMGAMVGIDPQSDGLARAQRMGVATTHEGVEGLTRL---PvfaDI-DIVFDAT 79  Dechloromonas a...
WP_011286671   4 KIKCALIGPGNIGTDLLAKLKR-SPFLEPVWMVGIDPESDGLRRAAEMGLKVTAEGVDGLLPHvlaD---GV-QIAFDAT 78  Dechloromonas a...
WP_011289531   3 KIRCALIGSGNIGTDLIYKIQR-SPVLEPVWMVGIDPESEGLARAREMGLKTTAAGVDGLLPHvleD---NI-QIAFDAT 77  Dechloromonas a...
WP_000756050   3 KVKAAIIGSGNIGTDLMYKLKN-SKVIELNAMIGIDSESDGLKRAKEAGYEVFDNGIQAIIDN---P---SLaDIVFDAT 75  Bacillus cereus
WP_011229062   4 RVKVAILGSGNIGTDLMYKLLKnPGHMELVAVVGIDPKSEGLARARALGLEASHEGIAYILER---P---EI-KIVFDAT 76  Thermus thermop...
WP_011393277   3 KVKVAVIGPGNIGSDLMYKILR-SRHLEMALMTGI-IESEGIKRARKLGIKTSIEGVKAVLAE---D---DI-KIVFDAT 73  Moorella thermo...
WP_011344189   4 KIKAAIIGPGNIGMDLMFKLMR-SKYIDVDTVVGIIPESEGLALARKHGKKTSAEGIKAILGN---K---DI-KIVFDAT 75  Carboxydothermu...
WP_012257234   5 KVKVAILGSGNIGTDLMYKLLKqPGRMELALVAGIDPASEGLARARQIGIPTATDGIESILAD---P---DI-RIVFDAT 77  Chloroflexus
WP_011206995   5 TVTAAIVGSGNISTDLLYKLLR-SQAIEPRWMIGIDPESEGLKRARGLGLETSHEGVDWLLAQ---S---ELpDMIFEAT 77  Nocardia farcinica
WP_011209582   3 RWKAAIVGSGNIGTDLMYKLLR-SEHVDPVYMVGIDPASEGLARAAQEGLDASAEGVDWLLSR---R---ELpDVVFEAT 75  Nocardia farcinica
WP_011288965  80 SAGAHVRNDAFLRSLkpNIRMVDLTPAAIGPYCIPVVNGAAHDEAL--NVNMVTCGGQATIPMVAAVSRVAKVHYGEIIA 157 Dechloromonas a...
WP_011286671  79 SAYVHAENSRKLNAL--GVMMIDLTPAAIGPFCVPPVNLKELVGRKemNVNMVTCGGQATIPMVAAISRVQKVKYGEIVA 156 Dechloromonas a...
WP_011289531  78 SAYVHAENSRKLNEL--GVMMIDLTPAAIGPLCVPPVNLKEHTEKLemNVNMISCAGQATIPIVHAISRIQSVSYGEIVA 155 Dechloromonas a...
WP_000756050  76 SAKAHSYHAKILEEL--GKIVIDLTPAAYGPFVCPAIRNNDFLDKQ--NVNMITCGGQATIPIVHAINEVANVTYAEIVA 151 Bacillus cereus
WP_011229062  77 SAKAHVRHAKLLREA--GKIAIDLTPAARGPYVVPPVNLKEHLDKD--NVNLITCGGQATIPLVYAVHRVAPVLYAEMVS 152 Thermus thermop...
WP_011393277  74 GAKPHLQHAPLLKEA--GKIAIDLTPAAVGPYVVPCVNLDQVKAEP--NLNMVTCGGQATVPIVYAINRVAGARYAEIVA 149 Moorella thermo...
WP_011344189  76 SAKAHLKHAPLLEQD--GKIAIDLTPAAVGPYCVPAVTMEEQLNCK--NVNMVTCAGQATTPIVYAINKIADVKYAEIVA 151 Carboxydothermu...
WP_012257234  78 SAKAHVRHARLLRDH--GRIAIDLTPAARGPYVVPPVNLGEHLEAH--NVNLITCGGQATIPLVYAVSRVTAVRYAEMVS 153 Chloroflexus
WP_011206995  78 SAYVHRAAAPRYAEA--GIRAVDLTPAAVGPAVVPPVNLGANLDAP--NVNMITCGGQATIPIVAAVSRVVPVPYAEIVA 153 Nocardia farcinica
WP_011209582  76 SAKVHAAAAPRYAAA--GITAIDLTPASVGPYVVPAVNLHEHLDAP--NLNMVSCAGQATIPILAAINRVADASYGEIVA 151 Nocardia farcinica
WP_011288965 158 SISSKSAGPGTRANIDEFTETTSKAIEAVGGAAKGKAIIILNPAEPPLIMRDTVYC-LS-E-L--VDEDEIAASVAQMAA 232 Dechloromonas a...
WP_011286671 157 TISSKSAGPGTRKNIDEFTRTTSGAIEKVGGAEKGKAIIIINPAEPPLMMRDTVHC-LT-EgT--PDQAKITESIHAMIK 232 Dechloromonas a...
WP_011289531 156 SLASKSIGPGTRANLDEFTYTTSNAIEIVGGARKGKALAIINPADPPMMMRNTISC-LTdE-E--PDEPRIIESVLAMIK 231 Dechloromonas a...
WP_000756050 152 TISSLSAGPGTRANIDEFTITTKRGIEEIGGADKGKAIIILNPAEPPILMRDTIYC-EV-K-D--MDEVSIYEAIHKMVE 226 Bacillus cereus
WP_011229062 153 TVASRSAGPGTRQNIDEFTFTTARGLEAIGGAKKGKAIIILNPAEPPILMTNTVRC-IP-E-DegFDREAVVASVRAMER 229 Thermus thermop...
WP_011393277 150 CIASKSAGPGTRQNIDEFTQTTAKALEVVGGAKKGKAIIILNPAEPPIMMHNTIYV-EV-E-K--PDIEAIRASVEAMVK 224 Moorella thermo...
WP_011344189 152 TISSRSAGPGTRQNIDEFTETTAKALEKIGGADKGKAIIILNPAEPPIMMRNTIYT-RV-A-N--PDAPGIIEAIEEMVG 226 Carboxydothermu...
WP_012257234 154 TVASRSAGPGTRQNIDEFTFTTARGLEAIGGAREAKAIIILNPAHPPILMRNTIYV-VP-EgD--FDEETVRQSVAQMVA 229 Chloroflexus
WP_011206995 154 SVSSVSAGPGTRANIDEFTKTTSRGVETIGGAQRGKAIIILNPAEPPMIMRDTIFCaIP-E-D--ADTDAIADSIHRMVA 229 Nocardia farcinica
WP_011209582 152 AIASHSAGPGTRQNLSEFSEKTGRALAQVAGADRAKAISVINPAEPPMNMRDTVYA-KV-R-N--PDADAIERAVLDMVA 226 Nocardia farcinica
WP_011288965 233 DVQKYVPGYRLKQKVQFDiipasrpinipgvgqrmsGL-K--TSVFLEVEGAAHYLPAYAGNLDIMTSAAKTTAERMAAR 309 Dechloromonas a...
WP_011286671 233 EVQKYVPGYRLVNGPVFD------------------GN-R--VSVFLEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEE 291 Dechloromonas a...
WP_011289531 232 EVQKYVPGYRLVNGPLFD------------------GK-R--VTVFMEVAGLGDYLPKYAGNLDIMTAAATRTAEMFAEE 290 Dechloromonas a...
WP_000756050 227 RVRTYVPGYSLKQEPMFD------------------GN-R--VTVFLEVEGAGDYFPPYAGNLDIMTAAALKVGEEFATQ 285 Bacillus cereus
WP_011229062 230 EVQAYVPGYRLKADPVFErlp------------tpwGE-RtvVSMLLEVEGAGDYLPKYAGNLDIMTASARRVGEVFAQH 296 Thermus thermop...
WP_011393277 225 EIQSYVPGYRLVVPPILD------------------GN-K--VTAAVEVEGAGDFLPKYSGNLDIITSAAVAVAEKLAQE 283 Moorella thermo...
WP_011344189 227 KIKKYVPGYRLKVPPIID------------------GD-K--ITTIIEVEGEGAYLPKYAGNLDIITAAAVAFADEVAKK 285 Carboxydothermu...
WP_012257234 230 DVQQYVPGYRLKSLPVIEqrs------------tpwGE-RpvIIMLLEVEGAGDFLPTYAGNLDIMTAAARRVGELFAAH 296 Chloroflexus
WP_011206995 230 DIQQYVPGYRLLNEPQFDepsv-----------vsgGLaK--VSVFVEVEGAGDFLPPYAGNLDIMTAAATKVGEVIAGQ 296 Nocardia farcinica
WP_011209582 227 EVQRYVPGYTLRL-IDVD------------------GD-L--VTVMLEVVGAGDFLPTYAGNLDIITAAAVQVADVLAQR 284 Nocardia farcinica
WP_011288965 310 ILS 312 Dechloromonas aromatica
WP_011286671 292 IIS 294 Dechloromonas aromatica
WP_011289531 291 ILA 293 Dechloromonas aromatica
WP_000756050 286 IVS 288 Bacillus cereus
WP_011229062 297 LLG 299 Thermus thermophilus
WP_011393277 284 LQV 286 Moorella thermoacetica
WP_011344189 286 LLA 288 Carboxydothermus hydrogenoformans
WP_012257234 297 LLS 299 Chloroflexus
WP_011206995 297 ITS 299 Nocardia farcinica
WP_011209582 285 TLV 287 Nocardia farcinica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap