1KMY


Conserved Protein Domain Family
23dbph12diox

?
TIGR03213: 23dbph12diox 
Click on image for an interactive view with Cn3D
2,3-dihydroxybiphenyl 1,2-dioxygenase
Members of this protein family all have activity as 2,3-dihydroxybiphenyl 1,2-dioxygenase, the third enzyme of a pathway for biphenyl degradation. Many of the extradiol ring-cleaving dioxygenases, to which these proteins belong, act on a range of related substrates. Note that some members of this family may be found operons for toluene or naphthalene degradation, where other activities of the same enzyme may be more significant; the trusted cutoff for this model is set relatively high to exclude most such instances. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 132257
View PSSM: TIGR03213
Aligned: 9 rows
Threshold Bit Score: 420.64
Threshold Setting Gi: 42475466
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KMY_A     2 IRSLGYMGFAVSDVAAWRSFLtQKLGLMEAGTTDNGDLF-RIDSRAWRIAVQQGEVDDLAFAGYEVADAAGLAQMADKLK 80  Burkholderia xenovo...
Q53034     4 VTGIGYIGIGVSDLPAWEEFA-ETIGFQIRERGEDGTLYlRMDKAHHRVAVHPTGEDDLTYVGWQVADENGFDELERTLR 82  Rhodococcus rhodoch...
P47228     3 IRSLGYMGFAVSDVAAWRSFLtQKLGLMEAGTTDNGDLF-RIDSRAWRIAVQQGEVDDLAFAGYEVADAAGLAQMADKLK 81  Burkholderia xenovo...
P13453     3 IQRLGYLGFEVADVRSWRTFAtTRLGMMEASASETEATF-RIDSRAWRLSVSRGPADDYLFAGFEVDSEQGLQEVKESLQ 81  Pseudomonas putida F1
P47231     3 VQRLGYLGIEVSDVDAWRTYAtMRLGAMEAPAPEGTARF-RLDSRAWRFMVTPGPADDLSVAGYEVDSEGALMQVKTRLE 81  Rhodococcus globerulus
AAK96189   6 VTELGYIGIGVSDMDAWREYAaNVMGLEVLEEGDKDRFYlRLDYQHHRIVVHNSGSDDLDYAGWRVAGPEEFDQIKRNLE 85  Burkholderia sp. DBT1
AAB06725   4 VSELGYLGMSVTDLDAWRAYAaEVAGMEVVDEGESDRIYlRMDLWHHRIALIKGDTDDLAYMGWRLGDPTEFESMVEKLT 83  Sphingobium xenophagum
BAD10887   4 LRGLGYLRIRTQDVPRWRELLiDGLGMAVGSGPEPDALYaRVDERRARIAVLPGDSDKALAVGWEVRDEFALERVREAVE 83  Rhodococcus rhodoch...
BAA25603   6 IKGLGYVKISTNDMARWRTFAfDVLGFAKGSGPDENALYlRLDERAARIVVVEGERDEIVNIGWEVADHAALRRVQEALE 85  Rhodococcus erythro...
1KMY_A    81 QAGIAVTTGDASLARRRGVTGLITFADPFGLPLEIYYGASEVfEKPFLPGAAVSg-FLTGEQGLG---HFVRCVPDSDKA 156 Burkholderia xenovo...
Q53034    83 AAGVPVEMAGEDDAELRGVARLMRFEDPSGIKSEAYYGLVSEpEVPYVSPYAVD--FVTEDQGFG---HIVVMVDDYDET 157 Rhodococcus rhodoch...
P47228    82 QAGIAVTTGDASLARRRGVTGLITFADPFGLPLEIYYGASEVfEKPFLPGAAVSg-FLTGEQGLG---HFVRCVPDSDKA 157 Burkholderia xenovo...
P13453    82 AHGVTVKVEGGELIAKRGVLGLISCTDPFGNRVEIYYGATELfERPFASPTGVSg-FQTGDQGLG---HYVLSVADVDAA 157 Pseudomonas putida F1
P47231    82 AYGVKVTSESSELAAERGVLGLISCVDPAGTRLEIYYGGTEMfEVPFASPTGVKe-FRTDDQGMG---HYVLAVPDVDAA 157 Rhodococcus globerulus
AAK96189  86 KARVDFRQADAAECDERMVLDLVKFLDPGGNPTEIYHGPRVDyHKPFHAGRRMHgrFSTGDQGLGhigHIILRQENPQKA 165 Burkholderia sp. DBT1
AAB06725  84 NAGIAVTVASDAEARERRVLGLAKLTDPGGNPTEIFYGPQVDaHKPFHPGRPMFgkFVTGSEGIG---HCILRQDDVEAA 160 Sphingobium xenophagum
BAD10887  84 KSGRAVEVLSRKEATYLDAEGAIAFEDPAGTRLEVFYGPVLD-HSPVVTPFAGR--WVTGGLGLG---HVVLPATNFDET 157 Rhodococcus rhodoch...
BAA25603  86 KNGTEVEQLSLAEADARRVEEVIAFTDPGGAAIEVFHGAILD-HSPVVTPFGAR--FVTGSQGLG---HVVLPVMDSAAS 159 Rhodococcus erythro...
1KMY_A   157 LAFYTDVLGFQLSDVIDMKMGp-DVT-VPAYFLHCNERHHTLAIAAFP--LPKRIHHFMLEVASLDDVGFAFDRVDADGL 232 Burkholderia xenovo...
Q53034   158 MRFYREVLGLQTSDLVKVGAG--GVQ-TRMAFMRCNPRQHSLAFWAGD--STTRLNHFMLQTQTLDQTGMTLDRCFHGGI 232 Rhodococcus rhodoch...
P47228   158 LAFYTDVLGFQLSDVIDMKMGp-DVT-VPAYFLHCNERHHTLAIAAFP--LPKRIHHFMLEVASLDDVGFAFDRVDADGL 233 Burkholderia xenovo...
P13453   158 LAFYTKALGFQLADVIDWTIGd-GLS-VTLYFLYCNGRHHSFAFAKLP--GSKRLHHFMLQANGMDDVGLAYDKFDAERA 233 Pseudomonas putida F1
P47231   158 LDFYVQGLGFHLSDVIDWQVSp-EVS-VRLHFLHCNGRHHTLAVVGMP--SDKKMHHLMIETTNLDDVGLAYDRCVEDDA 233 Rhodococcus globerulus
AAK96189 166 YEFYARVLGMRGSVEYHIPIPhiGIT-AKPIFLHSNDRDHSVAFLGGP--AAKRINHLMIEVDNIDDVGYTHDIVRKRQI 242 Burkholderia sp. DBT1
AAB06725 161 AAFY-RLLGLRGSVEYQLHLPn-GMV-AMPYFMHCNERQHSVAFGLGP--MEKRINHLMFEYTELDDLGLAHDIVRERQI 235 Sphingobium xenophagum
BAD10887 158 YEFYTQVLGFLPRGSIRLDEE--GLN--RVRFLGINERHHALALCPAPptEEPGLVHLMTEVDTLDAVGQALDRVNGMDF 233 Rhodococcus rhodoch...
BAA25603 160 FDFYTEVLGFYPRGAFRLPAPp-EFGpLRIRFMGVNERHHSLALCPAPhgGAPGLIHIMVEVDTLDAVGQALDRVMKDGF 238 Rhodococcus erythro...
1KMY_A   233 -ITSTLGRHTNDHMVSFYASTPSGVEVEYGW-SARTVDRSWVVVRHDSPSMWGHKS 286 Burkholderia xenovorans LB400
Q53034   233 -PATNLGRHVNDYAVSFYITTPSGFMIEYGW-GVREVVSDYPVDKYRSVSIWGHRN 286 Rhodococcus rhodochrous
P47228   234 -ITSTLGRHTNDHMVSFYASTPSGVEVEYGW-SARTVDRSWVVVRHDSPSMWGHKS 287 Burkholderia xenovorans LB400
P13453   234 -VVMSLGRHTNDHMISFYGATPSGFAVEYGW-GAREVTRHWSVVRYDRISIWGHKF 287 Pseudomonas putida F1
P47231   234 -VILTLGRHTNDHMVSFYGATPSGFAVEFGW-GSRVVEPGWSVVRYDAISIWGHKI 287 Rhodococcus globerulus
AAK96189 243 pVAVQLGKHSNDQMVSFYSANPSNWLFEYGAlGRR---ATYQS-EYYVSDIWGHEI 294 Burkholderia sp. DBT1
AAB06725 236 dVALQLGKHANDLALTFYCANPSGWLWEFGW-GAR---KAPAQQEFYTRDIFGHGN 287 Sphingobium xenophagum
BAD10887 234 sISSTLGRHTNDKMISFYVRAPGGWDLEFGTeGMLVDERHYTSEEITADAYWGHDQ 289 Rhodococcus rhodochrous
BAA25603 239 sVSSTLGRHTNDKMISFYVRAPGGWDIEFGTeGARVDQDSYSSEEITADSYWGHDW 294 Rhodococcus erythropolis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap