Conserved Protein Domain Family
badI

?
TIGR03210: badI 
2-ketocyclohexanecarboxyl-CoA hydrolase
Members of this protein family are 2-ketocyclohexanecarboxyl-CoA hydrolase, a ring-opening enzyme that acts in catabolism of molecules such as benzoyl-CoA and cyclohexane carboxylate. It converts -ketocyclohexanecarboxyl-CoA to pimelyl-CoA. It is not sensitive to oxygen.
Statistics
?
PSSM-Id: 132254
View PSSM: TIGR03210
Aligned: 3 rows
Threshold Bit Score: 467.5
Threshold Setting Gi: 0
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011156220             3 FEDLIYEIRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDRAFCTGGDQSTHDGNYDGRGTVG 82  Rhodo...
tigr_OMNI_NTL01REA0453   1 YEDILYEVRNGAAWITINRAEKMNAFRGRTCDELIHAINRAGYDREIGTIVLAGAGDKAFCTGGDQSAHEGQYDGRGTIG 80 
tigr_OMNI_NTL01AE1077    1 YQDILYTKEDGIATIMINRPAQYNAFRAQTCEEIIHALKDADFDRQIGVVVLTGAGDKAFCTGGDQGTQDGGYGGRGVIG 80 
WP_011156220            83 LPMEELHTAIRDVPKPVIARVQGYAIGGGNVLATICDLTICSEKAIFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWY 162 Rhodo...
tigr_OMNI_NTL01REA0453  81 LPMEELHNAIRDVPKPVIARVQGYAIGGGNVLCTICDFTIASEKAVFGQVGPKVGSVDPGYGTAYLARVVGEKKAREIWY 160
tigr_OMNI_NTL01AE1077   81 LPVEEMQSAIRDIAKPVIARVNGFAIGGGNVLVTVCDLAIASEKAQLGQAGPRVGSVDPGFGTALLARVVGEKKAREIWY 160
WP_011156220           163 MCKRYSGKEAEAMGLANLCVPHDELDAEVQKWGEELCERSPTALAIAKRSFNMDTAHQAGIAGMGMYALKLYYDTDESRE 242 Rhodo...
tigr_OMNI_NTL01REA0453 161 LCRRYPAAEALAMGLVNAVVPHEQLDAEVQKWCDEILEKSPTAVAIAKRSFNMDTAHQSGIAGMGMYALKLYYDTEESRE 240
tigr_OMNI_NTL01AE1077  161 LCRRYTAQEALAMGLVNAVVPHDQLDAEVKKWCDEIVEKSPTAIALAKKSFNVDTEMIRGMGGLAMHALKLYYETAESAE 240
WP_011156220           243 GVKALQEKRKPEFRKY 258 Rhodopseudomonas palustris
tigr_OMNI_NTL01REA0453 241 GVKAFQEKRKPEFRKY 256
tigr_OMNI_NTL01AE1077  241 GGNAFREKRKPEFRKY 256
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap