Conserved Protein Domain Family
P21_Cbot

?
TIGR03209: P21_Cbot 
clostridium toxin-associated regulator BotR
Clostridium botulinum neurotoxin production is regulated by a regulatory sigma-70 protein, BotR transcription regulator. Similarly, tetanus toxin production of Clostridium tetani is regulated by TetR which is a very close relative of BotR. Both BotR and TetR are members of the TIGR02937 subfamily of sigma-70 RNA polymerase sigma factors. Functional complementation experiments have been done for botR and tetR in highly transformable strain of Clostridium perfringens host cells to assess functional interchangeability of sigma factors and it has been confirmed that they are interchangeable in vivo.
Statistics
?
PSSM-Id: 132253
View PSSM: TIGR03209
Aligned: 5 rows
Threshold Bit Score: 167.29
Threshold Setting Gi: 6729208
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAA89708      18 FNFIEMSLKKYIEKTSKKYNLYYDYyNDILYHLWKELIEINLKNFNSELDLRKYISTSIKRYCINICKKKNRDKKIIYNS 97  Clostridium bot...
CAA61227      21 FEEIYRNFENFIDMLTRKYDVEKDY-NDIVSHLWIILKKTDLNKFNTEYDLEKYISTSLKRYCIDICNKKNRNERVIYNS 99  Clostridium bot...
CAA65350      18 FEDIYTNYKNLIDIFIKKYNLSENY-NDILNHFWIILKKADLNKFNTENDLNKYISKCLKRYCLSICMKKNRDKKIIYNS 96  Clostridium bot...
AAB64349      18 FQEIFKHFEKTINIFTRKYNIYDNY-NDILYHLWYTLKKVDLSNFNTQNDLERYISRTLKRYCLDICNKRKIDKKIIYNS 96  Clostridium bot...
WP_011100837  18 FEVIIIHFKNTVNILIRKYNLESHY-NDILYHLWNILKKIDLNKFNTENDLHKYISRSLKRYCLDICNKKNRDKKIIYNS 96  Clostridium tetani
BAA89708      98 EVTYKKLDAV-NVYSLYCDNFEFLDLISILNYKEKQIIYMKFFECRKDNEIARRLHLSRQSIYK 160 Clostridium botulinum
CAA61227     100 EFVDINLSLI-EHSFSNDLEFEFNDLISILPNSQRKIIYMRFFNNMKEVDIAEELNISRQAVYK 162 Clostridium botulinum
CAA65350      97 EITNINLNLI-QDNCFNDIEFEFKDLISILPNTQKNIIYMKFFKDMKDIQIAKKLKISRQSVYK 159 Clostridium botulinum F str. La...
AAB64349      97 EIADKKLSLIaNSYSSY-SEFEFNDLISILPDDQKKIIYMKFVEDIKEIDIAKKLNISRQSVYK 159 Clostridium botulinum
WP_011100837  97 EITNIKLNLM-ENSCSNYLNFEFNDLISILPENQRKILYMKFFEDMKECDIAKKLHMSRQAVYK 159 Clostridium tetani
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap