Conserved Protein Domain Family
cyc_hxne_CoA_lg

?
TIGR03208: cyc_hxne_CoA_lg 
cyclohexanecarboxylate-CoA ligase
Members of this protein family are cyclohexanecarboxylate-CoA ligase. This enzyme prepares the aliphatic ring compound, cyclohexanecarboxylate, for dehydrogenation and then degradation by a pathway also used in benzoyl-CoA degradation in Rhodopseudomonas palustris.
Statistics
?
PSSM-Id: 132252
View PSSM: TIGR03208
Aligned: 3 rows
Threshold Bit Score: 1007.52
Threshold Setting Gi: 499556147
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011156218   3 FDAVLLPPRRAASIAAGLWHDRTINDDLDACVAHCPDKVALTAVRLDGGAVRRFSYRELATLADRVAVGLNRLGVGRGDV 82  Rhodopseudomona...
WP_011300042   3 FDAVLIAPRRAASVAAGLWRDRTINDYFDATVARAPDGPALTSLQVESGAVRHFTWRQLDAMVTRIAVGLRRLGIERNDV 82  Cupriavidus pin...
WP_011236930   3 FEPVLLADRMDAMKAAGLWRDETIDVHFQRALENCPDKPAVVAYRDGHPEPVRLSYRELDCRVDRIARGLAALGVGRGDV 82  Aromatoleum aro...
WP_011156218  83 VAMQLPNWWQFTVLYLACSRIGAVLNPLMPIFRERELSFMLKHGDAKVLVVPKSFRGFDHEAMARSLQPDLPALRTIVVV 162 Rhodopseudomona...
WP_011300042  83 VSCQLPNGWEVTALYLACARIGAVLNPLMPIFRERELSFMLAHADSKVVVVPQRFRGFDHAGMLAGLRDSLPALRHVVIT 162 Cupriavidus pin...
WP_011236930  83 VSFQLPNRWEFVALALACARIGAAANPVMPIFRQHELTYMLNFAESKVFIVPSVFRKFDHAAMARELQSKAPHLRQVVVI 162 Aromatoleum aro...
WP_011156218 163 DGGGADDFDTLLTTPEWEKQPDAAAILQGSRPSPDDITQLIYTSGTTGEPKGVMHSANTLMANIVPYAQRLALRESDVIL 242 Rhodopseudomona...
WP_011300042 163 GSDGPDGFEAMLCGADRDSDPDAAAILRRDRPSPDDVTQLIYTSGTTGEPKGVMHTANTLLSNILPYAERLRLGAGDVVL 242 Cupriavidus pin...
WP_011236930 163 DGDGDDSFDRVLM---RDDTPP----LAGPALGPDDVALLMYTSGTTGEPKGVMHTSNTLFSNLHAYIERMELGGGDVIL 235 Aromatoleum aro...
WP_011156218 243 MASPMAHQTGFMYGLMMPIMLRASAVLQDIWEPTKAAELIRTERVTFTMASTPFLTDLTRVVKESGEPVPSLKT-FLCAG 321 Rhodopseudomona...
WP_011300042 243 MASPMAHQTGFMYGLMMPVVLGAHAVLQDIWNPVQAARLIRETGVTFTMGSTPFLTDLARTVEESGQPVPSLRT-FLCAG 321 Cupriavidus pin...
WP_011236930 236 GASPMAHLTGYGYLAMLPLILNSTTVLQETWNAARALEIVRETGVTFSMASAAFISDLCTAV-EAGAPVSSQFTkFNCAG 314 Aromatoleum aro...
WP_011156218 322 APIPGPLVEQAQAGLGAKIVSAWGMTENGAVTLIKLDDDDKLASTTDGCPLPGVEVKVIDGDGKTLPPNQIGRLVVRSCS 401 Rhodopseudomona...
WP_011300042 322 APIPGALVERARTALGASIVSAWGMSENGAVTTTLPDDSEERASTTDGLPLPGVEVKVVDAQDASVLAGEVGRLLVRACS 401 Cupriavidus pin...
WP_011236930 315 APIPPIVIQRAWELMGLLVCSAWGMTECGAVTVTEPARALEKSGVSDGRPVPGIEVKIIDANGAKLSQGETGSLLIRGAS 394 Aromatoleum aro...
WP_011156218 402 NFGGYLKRPHWNGTDADGWFDTGDLAYMTADGYIRISGRSKDVIIRGGENIPVVEVEALLYKHPAVAQVAIVAYPDERLG 481 Rhodopseudomona...
WP_011300042 402 NFGGYLKRPQLNATDAEGWFDTGDLAKLDAEGYVRIAGRSKDVIIRGGENIPVVEIETLLYRHPAVAQVAIVAYPDERLG 481 Cupriavidus pin...
WP_011236930 395 LFAGYLKRPHLNSVDAEGWFDTGDLAFQDAEGYIRINGRNKDIVIRGGENIPVIEIENLLYQHPSITTVAVVGYPDRRLG 474 Aromatoleum aro...
WP_011156218 482 ERACAVVVPKTGASIDFAAMVEFLKAQKLALQYIPERLVVRDAMPATPSGKIQKFRLRE 540 Rhodopseudomonas palustris
WP_011300042 482 ERACAVVVPRQGQGFDKPAMVDFLKAQKVALQYIPERLIVQDALPATPAGKIQKFRLRE 540 Cupriavidus pinatubonensis
WP_011236930 475 ERICAFVSLKPGCTLTFADLTAYLDRQQVAKQYYPERLEIVDDLPRTPAGKLQKFKLRE 533 Aromatoleum aromaticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap