Conserved Protein Domain Family
cyc_hxne_CoA_dh

?
TIGR03207: cyc_hxne_CoA_dh 
cyclohexanecarboxyl-CoA dehydrogenase
Cyclohex-1-ene-1carboxyl-CoA is an intermediate in the anaerobic degradation of benzoyl-CoA derived from varioius aromatic compounds, in Rhodopseudomonas palustris but not Thauera aromatica. The aliphatic compound cyclohexanecarboxylate, can be converted to the same intermediate in two steps. The first step is its ligation to coenzyme A. The second is the action of this enzyme, cyclohexanecarboxyl-CoA dehydrogenase.
Statistics
?
PSSM-Id: 132251
View PSSM: TIGR03207
Aligned: 3 rows
Threshold Bit Score: 719.007
Threshold Setting Gi: 499469579
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011236929   5 LSPEQQALVDTANRFARERLAPGYKAREKAERIEREVIRDMGELGFLGPELSEEHGGLGVDCLTSGLLLEQISYGDFNVS 84  Aromatoleum aro...
WP_011300041   5 LNEDLQALAEHARRFADACIAPGFLERDKTRVLDRSLMRQMGEMGFIGPELPEAYGGQGMGCLAAGVIHEAVARADLSMS 84  Cupriavidus pin...
WP_011156219   5 LNEDLVALAAQARRFAADRIAPGFQERDRTRVLDRGLMKAMGEMGFIAPELPEVCGGLGMGSLAAGVIHEEIARADLSMS 84  Rhodopseudomona...
WP_011236929  85 YVNLLTSLCGQIVAGHARPDIAKEWLGQVIAGHKTIAIALTEPSAGSDAARLKLKAVRDGNDFVLNGEKTSISMATQSDV 164 Aromatoleum aro...
WP_011300041  85 YVNLLASLNGQILAQHALPEVGRPWLQRLTRGEALFAIALTEPRGGSDAGSLRLRMERVGDSYVLNGEKTSISAADQADA 164 Cupriavidus pin...
WP_011156219  85 YVNLLASLNGQILSQHGRPEIVQPWLAKLIGGEALFAIALTEPRGGSDAANLRLRIERDGDDYIVNGEKTSISAADQADA 164 Rhodopseudomona...
WP_011236929 165 AVVFARTGSEAERARGISAFLVPMDLPGITRTAFDDIGTRPVGRGSIFFDDVRVSADMMLGNEGQGFIQVMQGFDYSRAL 244 Aromatoleum aro...
WP_011300041 165 AVVFARTGSVEDGARGISAVLVPMDLPGVTRNRFDCHGQRAIGRGSIFFENVRVPADHLLGTEGQGFVQVMQGFDFSRAL 244 Cupriavidus pin...
WP_011156219 165 AVVFGRTGSIDAGAHGVTALLIPMDLPGITRNRFDCHGQRAIGRGSLFFENVRVPAAHRLGDENKGFVQVMQGFDFSRAL 244 Rhodopseudomona...
WP_011236929 245 IGLQCMGVVRASLDETWRYIQEREAFGKKIGDFQGVTFPLAEAETMYEACRALCLRTLWLKDQGLPHTSEAAMCKWWAPK 324 Aromatoleum aro...
WP_011300041 245 IGLQVLAVAQAALDETWEYVAERQAFGKPLSAFQGVSHPLADFETQVTAARLLCLQTLWLKDHGLPHTSEAAMCKWWAPK 324 Cupriavidus pin...
WP_011156219 245 IGLQVLAVARVALEETWAHVAERQAFGKPLSAFQGVSHPLADLDTQVEAARLLCLQALWLKDHGAPHSAEAAMCKWWAPK 324 Rhodopseudomona...
WP_011236929 325 LACEIIHQCLLTHGHGGYASDyDFGQRYRDVMGLQIGDGTANIMKMIIGREKL 377 Aromatoleum aromaticum
WP_011300041 325 LAYDVVHQCLLSFGHGGYDRG-VMEQRLRDVLGFQIGDGTAQIMKTIIARHRA 376 Cupriavidus pinatubonensis
WP_011156219 325 LAYDVIHQCLLMHGHGGYDRG-PMEQRLRDVLGFQIGDGTAQIMKTIIARHRA 376 Rhodopseudomonas palustris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap