Conserved Protein Domain Family
benzo_BadH

?
TIGR03206: benzo_BadH 
2-hydroxycyclohexanecarboxyl-CoA dehydrogenase
Members of this protein family are the enzyme 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. The enzymatic properties were confirmed experimentally in Rhodopseudomonas palustris; the enzyme is homotetrameric, and not sensitive to oxygen. This enzyme is part of proposed pathway for degradation of benzoyl-CoA to 3-hydroxypimeloyl-CoA that differs from the analogous in Thauera aromatica. It also may occur in degradation of the non-aromatic compound cyclohexane-1-carboxylate.
Statistics
?
PSSM-Id: 132250
View PSSM: TIGR03206
Aligned: 3 rows
Threshold Bit Score: 428.571
Threshold Setting Gi: 499556144
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011156221   4 LQNKTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAVRCDIADRTSVDAAIATTTTTLGP 83  Rhodopseudomona...
WP_011300039   4 LKGKTVIVTGGGGGIGGATCLRFAREGAAVAVLDLSAEAARKVADRIAETGGKALAIACDITDRASVDLAVAAVREGLGP 83  Cupriavidus pin...
WP_011236927   4 IKDKVAIVTGGAGGIGSAICRRFGEEGAKVAVFDINREAAETVAADIRAKGGNAQAFAVDLTSQDSVITAVSAAEQALGP 83  Aromatoleum aro...
WP_011156221  84 VDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHMHHAVLPGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLV 163 Rhodopseudomona...
WP_011300039  84 VDVLVNNAGWDVFRPFTKTEPAQWERLIAINLTGALHMHHAVLPGMVERKQGRIVNIASDAARVGSSGEAVYAACKGGLV 163 Cupriavidus pin...
WP_011236927  84 TDVLVNNAGWDKIGNFLSTDKPLWDKIVAINLYGALYMHHAVAKGMVERGAGRIVNIASDAGRGGSSGEAVYSFCKGGLI 163 Aromatoleum aro...
WP_011156221 164 AFSKTLAREHARHGITVNVVCPGPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAGFITGQ 243 Rhodopseudomona...
WP_011300039 164 SFSKTIAREHARHGITVNVVCPGPTQTALFEDYKQGAGNPEKLMEAFTRSIPLGRIGQPDDLPGAITFFASDDAAFITGQ 243 Cupriavidus pin...
WP_011236927 164 AFSKTMARELARQQISVNVVCPGPTDTPLLDDICGEGEKGDKLRTAFTRAVPFGRLGQPDDLPGAILFLSSDDASFITGQ 243 Aromatoleum aro...
WP_011156221 244 VLSVSGGLTM 253 Rhodopseudomonas palustris
WP_011300039 244 VLSVSGGLTM 253 Cupriavidus pinatubonensis
WP_011236927 244 VLSVSGGLTM 253 Aromatoleum aromaticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap