Conserved Protein Domain Family
pimA

?
TIGR03205: pimA 
dicarboxylate--CoA ligase PimA
PimA, a member of a large family of acyl-CoA ligases, is found in a characteristic operon pimFABCDE for the metabolism of pimelate and related compounds. It is found, so far, in Bradyrhizobium japonicum and several strains of Rhodopseudomonas palustris. PimA from R. palustris was shown to be active as a CoA ligase for C(7) to C(14) dicarboxylates and fatty acids.
Statistics
?
PSSM-Id: 132249
View PSSM: TIGR03205
Aligned: 3 rows
Threshold Bit Score: 1119.66
Threshold Setting Gi: 499403077
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011090544   2 THPGEQFYPEGVRWDDTIVQGTLPDLLSKAAADYGPRTALEFRERPITYTELAAMAERAAAAFLRAGCGKSASVALFLGN 81  Bradyrhizobium ...
WP_011472680   5 THPGEQFYPAGLTWDAPVARGTLPDLLSTSATRYGARPAIEFRDRAISFTELEALVETAAAALLRAGYGKDCSVGLYLGN 84  Rhodopseudomona...
WP_011159254   2 SHPGEQYYPPGVRWDAVIARGTLPELLAQAAKDYASRPALEFRDRQITYTKLEAMAETAAAALLAAGYGRDSSVALYIGN 81  Rhodopseudomona...
WP_011090544  82 TPDHPVNFFGALKAGARVAHLSPLDGEIALTHKVSDSGSRLLVTSNLAALLPTALKFLEKGLIDRLVVCEDDNWGKVGTP 161 Bradyrhizobium ...
WP_011472680  85 LPDHPINFFGALKAGARVVHLSPLDGERALSHKLSDSGARILITSDLAGLLPMALKFLEKGLLDRLIVCDDEHWGAVGNP 164 Rhodopseudomona...
WP_011159254  82 TPDHPINFFGALKAGARVVHLSPLDGERALSHKLSDSGARVLITTDSAALLPMAERFLAKGLLDRLIVCSDASWGESATP 161 Rhodopseudomona...
WP_011090544 162 QAAIPADPRIVTFKTFVEGAAAPAEWPQVTADDVALLQYTGGTTGLPKGAMLTHGNLTSAVSIYDVWGKPSRATRGDVvE 241 Bradyrhizobium ...
WP_011472680 165 HTPIPDDPRIVRYADFTKDATPPAQWPALKPDDVAVLQYTGGTTGLPKGAMLSHGNLTSAVSIYDLWGARDRAERNTV-E 243 Rhodopseudomona...
WP_011159254 162 LAPLPSDPRVITYADFIKGASKPMAWPAIVPDDIALLQYTGGTTGLPKGAMLTHSNLTSAVAIYDVWGL-VRANSGGI-H 239 Rhodopseudomona...
WP_011090544 242 RVICVLPLFHIYALTVVLLSSLRRGNLISIHQRFDVEAVMRDIEVKRATYFPGVPTMWIAIAALPDLDKRDFSSLATIGS 321 Bradyrhizobium ...
WP_011472680 244 RVICVLPLFHIYALTVILLRSLNNGDLISLHQRFDVAAIFRDIEEKRATVFPGVPTMWIALANDPSLESRDLSSLATCGS 323 Rhodopseudomona...
WP_011159254 240 RVICVLPLFHIYALTVILLRCLKQGDLISLHQRFDVAAVFRDIEEKRATVFPGVPTMWIALANDPSLEKRDLSSLTMAGS 319 Rhodopseudomona...
WP_011090544 322 GGAPLPVEIANFFERKVGKKLRSGWGMTETCSPGTGHPPTGPDKPGSIGLMLPGIELDVVSLDDPTKVLPPGEVGEIRIK 401 Bradyrhizobium ...
WP_011472680 324 GGAPLPVEVAKVFERKTGLQLKSGWGMTETCSPGTSHPLEGPDKPGSIGLMLPGIELDVVSLDDTSKPLPPGEVGELRIR 403 Rhodopseudomona...
WP_011159254 320 GGAPLPVEVARLFERKTNLKLKSGWGMTETCSPGTGHPPEGPDKPGSIGLMLPGIELDVVALDDPKRVLPPGEVGELRVR 399 Rhodopseudomona...
WP_011090544 402 GPNVTRGYWNKPEGSAEAFIDGRFLTGDIGYVDTDGYFFLVDRKKDMIISGGFNVYPQMIEQAIYTLPGVHEVIVLGIPD 481 Bradyrhizobium ...
WP_011472680 404 GPNVTRGYWNRAQETAEAFVGDRFLTGDIGTMDRDGYFFLVDRKKDMIICGGFNVYPQMIEQAIYEHPSVQEVIVIGIPD 483 Rhodopseudomona...
WP_011159254 400 GPNVTKGYWNRPEESAHSFVGDRFLTGDIGYMDQDGYFFLVDRKKDMIISGGFNVYPQMIEQAIYEHPAVQEVIVIGVPD 479 Rhodopseudomona...
WP_011090544 482 QYRGEAAKAFIKLKPGAKPFSLDELRAQLAGKVGKHEMPVEVEFVDDLPRTPVGKLSRHELR 543 Bradyrhizobium diazoefficiens
WP_011472680 484 QYRGEAAKAFVKLRSGAAPFSVDALREFLKGKLGKHELPAALELVDELPRTSVGKLSRHELR 545 Rhodopseudomonas palustris
WP_011159254 480 DYRGEAAKAFVKLREGAKPFSIDELRAFLTGKLGKHELPTAVEFLDELPRTTVGKLSRHELR 541 Rhodopseudomonas palustris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap