Conserved Protein Domain Family
pimC_large

?
TIGR03204: pimC_large 
pimeloyl-CoA dehydrogenase, large subunit
Members of this protein family are the PimC proteins of species such as Rhodopseudomonas palustris and Bradyrhizobium japonicum. The pimFABCDE operon encodes proteins for the metabolism of straight chain dicarboxylates of seven to fourteen carbons. Especially relevant is pimeloyl-CoA, basis of the gene symbol, as it is a catabolite of benzoyl-CoA degradation, which occurs in Rhodopseudomonas palustris.
Statistics
?
PSSM-Id: 132248
View PSSM: TIGR03204
Aligned: 3 rows
Threshold Bit Score: 878.199
Threshold Setting Gi: 499791948
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011159252   2 DLNFSKEEIAFRDEVRQFFKDNVPAKTRQKLIEGRHNTKEEMVEWYRILNKKGWAVTHWPKEYGGTGWSSVQHYIFNEEL 81  Rhodopseudomona...
WP_011090542   2 DLAFTKEEQAFREEVRSFFRDNVPPDTRRKLVEGRHLSKDEMVTWWRILNKKGWGVSHWPKQYGGTGWTSVQHYIFNEEL 81  Bradyrhizobium ...
WP_011472682   2 DLSFSKDELAFRDEVRAFFKDNVPAALRQKLMEGRHPTKQEMVDWWRVLNAKGWGVPHWPKQYGGTGWTSVQDYIFNEEL 81  Rhodopseudomona...
WP_011159252  82 QAAPAPQPLAFGVSMVGPVIYTFGSEEQKKRFLPRIANVDDWWCQGFSEPGSGSDLASLKTKAEKKGDKWIINGQKTWTT 161 Rhodopseudomona...
WP_011090542  82 QSYPAPQPLAFGVSMVGPVIYTFGNEEQKKKYLPRIANVDDWWCQGFSEPGSGSDLASLKTKAERKGDKWIINGQKTWTT 161 Bradyrhizobium ...
WP_011472682  82 QMAPAPAPLAFGVSMVGPVIYTFGNEAQKARFLPRIANVDDWWCQGFSEPGSGSDLASLKTKAEKKGDTYIVNGQKTWTT 161 Rhodopseudomona...
WP_011159252 162 LAQHADWIFCLCRTDPAAKKQEGISFILVDMKTKGITVRPIQTIDGGHEVNEVFFDDVEVPLENLVGQENKGWDYAKFLL 241 Rhodopseudomona...
WP_011090542 162 LAQHADMIFCLCRTDATAKKQMGISFIVFSMKSKGVTVRPIQTIDGGVEVNEVFFDDVEVPYENLIGEENKGWDYAKFLL 241 Bradyrhizobium ...
WP_011472682 162 LAQHADWIFCLCRTDPTAKKQSGISFILVDMKSKGITVRPIQTIDGSSEVNEVFFDDVEVPVENLVGEENKGWDYAKFLL 241 Rhodopseudomona...
WP_011159252 242 GNERTGIARVGMSKERIRRIKQLAAQVESGGKPVIEDPKFRDKLAAVEIELKALELTQLRVVADEGKHGKGKPNPASSVL 321 Rhodopseudomona...
WP_011090542 242 GNERTGIARVGVSKERLRRIRDLASKVESGGKPIIQDAAFREKLAACEIELKALELTQLRVVADEGKHGKGKPNPASSVL 321 Bradyrhizobium ...
WP_011472682 242 GNERTGIARVGVSKERIKRIKELAAKVQAGGKPVLEDQKFREKLALVEIELKALELTQLRVVANEGKHGKGKPDPASSVL 321 Rhodopseudomona...
WP_011159252 322 KIKGSEIQQATTELLMEVIGPFAAPYDVHGDDDSNETMDWTAQIAPGYFNNRKVSIYGGSNEIQRNIICKAVLGL 396 Rhodopseudomonas pal...
WP_011090542 322 KIKGSEIQQTTTELLMEVIGPFAAPYDVHGDDGSNEAMEWTAQIAPSYFNNRKVSIYGGSNEIQRNIIAKAVLGL 396 Bradyrhizobium diazo...
WP_011472682 322 KIKGSEIQQATTELLMNVIGPFAAPYDIHGDDGSNEAMDWTAQIAPSYFNNRKVSIYGGSNEIQRNIISKAVLGL 396 Rhodopseudomonas pal...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap