Conserved Protein Domain Family
pimD_small

?
TIGR03203: pimD_small 
pimeloyl-CoA dehydrogenase, small subunit
Members of this protein family are the PimD proteins of species such as Rhodopseudomonas palustris, Bradyrhizobium japonicum. The pimFABCDE operon encodes proteins for the metabolism of straight chain dicarboxylates of seven to fourteen carbons. Especially relevant is pimeloyl-CoA, basis of the gene symbol, as it is a catabolite of benzoyl-CoA degradation, which occurs in Rhodopseudomonas palustris.
Statistics
?
PSSM-Id: 132247
View PSSM: TIGR03203
Aligned: 3 rows
Threshold Bit Score: 734.115
Threshold Setting Gi: 499403074
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011159251   2 DFDLSEEQRLLKESVEGLLKGSYDFDSRKKYAKEKGGWSRAVWGKFAEQGLLGLPFSEEDGGFGAGAVETMIVMEALGHS 81  Rhodopseudomona...
WP_011472683   2 DFDLSEEQRLLKDSVEGLLKTSYDFDARKKYQAEPGGWSKTVWSKLAEQGLLGLPFSEADGGFGAGSVETMIVMEALGKA 81  Rhodopseudomona...
WP_011090541   2 DFDLSEEQRLLKESIDGLLTDSYDFESRKKYMKEKGGWSQAVWGKLAEQGLLGLPFSEADGGFGGGGVETMIVMEALGKA 81  Bradyrhizobium ...
WP_011159251  82 LVLEPYLPTVVIGGGFLRRAGSAAQKAAHLPGIIDGSKTFAFAQLEKNSRWDLGDVSTTAKKSGDGWVIDGEKFVVLNGE 161 Rhodopseudomona...
WP_011472683  82 LVVEPYLATVVLGGGFLRHGGSAEQKAAHLPGLIDGSKTFAFAQLEKNSRYDLGDVTTTAKKTGAMWVLDGEKFVVLHGE 161 Rhodopseudomona...
WP_011090541  82 LVLEPYLATVVICGGFLRHAGSDAQKAAYVPGIIDGSKTLAFAQLEKNSRYDLFDVSTTAKKKADGWIIDGEKFVVLNGE 161 Bradyrhizobium ...
WP_011159251 162 AADTLIVTARTKGGQRDRTGVGVFLVPADAKGITRKGYPTQDGLHAADITFTGVQVGADAAIGDPENALELIEAVVDDAR 241 Rhodopseudomona...
WP_011472683 162 TADTLIVTARSKGARRDRDGIGVFLVPAGAKGVSIKGYPTQDGLQAADISLSGVVIDADCAIGDPENGLPLVERVVDDAR 241 Rhodopseudomona...
WP_011090541 162 NAATLLVTARTKGDRRDKTGIGVFLVPANAKGVTKKSYPTQDGLHAADITFTGVEVGADAAIGNPEDALALIERVVDEAR 241 Bradyrhizobium ...
WP_011159251 242 TALCAEAVGLMDESLTTTVEYIKTRKQFGVPIGSFQVLQHRAADMFVATEQARSMAMFATMAAEFDDAKERAGAIAAAKV 321 Rhodopseudomona...
WP_011472683 242 AALCAEAVGAMDESLKSTVDYMKTRTQFGVPIGSFQVLQHRAADMFVAVEQARSMALFATMASDFDDARERANAIAAAKV 321 Rhodopseudomona...
WP_011090541 242 VALCAEAVGLMDESLKTTVEYIKTRKQFGVAIGSFQSLQHRASDMFVAAEQARSMSMFATMANDFENAKERSNAIAAAKV 321 Bradyrhizobium ...
WP_011159251 322 QIGKSGKFVGQQSIQLHGGIGMTMEAKIGHYFKRLTMIEQTFGDTDHHLARVSAGGGL 379 Rhodopseudomonas palustris
WP_011472683 322 QVGQSLKFVGEQAIQLHGGVGMTMEYKIGHYFKRLTMIEHAFGDSDFHLSRVSAAGGL 379 Rhodopseudomonas palustris
WP_011090541 322 QIGKSLKFVGQQSIQLHGGIGMTMEAKIGHYFKRLTMIENTFGDTDYHQRRVADAGGL 379 Bradyrhizobium diazoefficiens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap