Conserved Protein Domain Family
pucB

?
TIGR03202: pucB 
xanthine dehydrogenase accessory protein pucB
In Bacillus subtilis the expression of this protein, located in an operon with the structural subunits of xanthine dehydrogenase, has been found to be essential for XDH activity. Some members of this family appear to have a distant relationship to the MobA protein involved in molybdopterin biosynthesis, although this may be coincidental.
Statistics
?
PSSM-Id: 132246
View PSSM: TIGR03202
Aligned: 4 rows
Threshold Bit Score: 298.654
Threshold Setting Gi: 497653932
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011248579   3 TVAICLAAGQSARMGEN--KLALPLLETTVGSASLKTALGTDVAKIVVVIGEKyghtSWLD-PKlLA--DRRIMLVCCRK 77  Bacillus clausii
WP_000706287   3 IVGIYLAAGKSRRTGPGlhKLYLPTGNTLLGNKALHTSLSSNLSDVIVVSNQP----SWLL-HY-TQ--VERVHILSCEK 74  Bacillus cereus
WP_011229884   6 IAAIYLAAGQSRRMGAD--KRALPWGDGTLGTAGLKAALRSRLSPVIVVVPPDda-lAWLP-DElRN--HENCRFTRCAD 79  Geobacillus kau...
WP_009968116   6 LIGVFLAAGKSRRMGQN--KLALPLKGENIGSLSLKTALSSRLDHVLVVERTEhaslEWIGaPYhAPpfQKRWSLHVCQD 83  Bacillus subtilis
WP_011248579  78 AAEGQAESLKCGLEVAGALGASAVLILLADQPFLPASVIKSVLATAKRRPDaTSVSACYKGKQRPPALFRQSLFVKLHAL 157 Bacillus clausii
WP_000706287  75 SCLGQSYSLHCGLEKAESMNADGVVVMLADQPFITVKLLNSLIDSYEHLPQlDYVAASFQGIPQPPILFSKGIFPSLKKL 154 Bacillus cereus
WP_011229884  80 HCRGQAHSLACGLRESLASGADAAVVLLADQPFVTADVINALTDLYRRHRP-DYVAFTRFGTPMPPVIFGKQTFPALLAL 158 Geobacillus kau...
WP_009968116  84 AEKGQGHSVSSGVRKAESMGADGIVILLADQPQLSVDHLNALVALA---PE-SFAVSSFLGAFTPPIYFSSTCFPYVKGL 159 Bacillus subtilis
WP_011248579 158 AGDEGARAV-L--RKDKSSLAVPVADASAFFDIDTKEDY 193 Bacillus clausii
WP_000706287 155 KGDQGARSIfF--DKSFQGKITVYSDAKLFYDVNTIEDY 191 Bacillus cereus
WP_011229884 159 RGDAGGRTL-F--HHPRWRGLLYEGDEtigididtiddy 194 Geobacillus kaustophilus
WP_009968116 160 KGDEGARRL-LksGQLGAGAVLEAKDSGELDDIDTPRGI 197 Bacillus subtilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap