Conserved Protein Domain Family

TIGR03201: dearomat_had 
6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase
Members of this protein family are 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase, an enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. The experimentally characterized form from T. aromatica uses only NAD+, not NADP+. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA.
PSSM-Id: 132245
Aligned: 3 rows
Threshold Bit Score: 581.477
Threshold Setting Gi: 19571180
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_011384543 340 INVKNFVERRPLDSINDTFAAVHDHKLSRRAVLCP 374 Magnetospirillum magneticum
WP_011238811 319 IQLGPFVETRPMSQIEHVFDEAHHGKLKRRVILTP 353 Aromatoleum aromaticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap