Conserved Protein Domain Family
dearomat_had

?
TIGR03201: dearomat_had 
6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase
Members of this protein family are 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase, an enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. The experimentally characterized form from T. aromatica uses only NAD+, not NADP+. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA.
Statistics
?
PSSM-Id: 132245
View PSSM: TIGR03201
Aligned: 3 rows
Threshold Bit Score: 581.477
Threshold Setting Gi: 19571180
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA12244      20 RWMMTSPGAPMVRAEFEIGELSADQVVVAVAGCGVCHTDLGYYYDSVRTNHALPLALGHEISGRVVQAGANAAQWLGRAV 99  Thauera aromatica
WP_011384543  25 RWMMTGVGQPMVKEAMEIAAPGAGEVLVEVAGCGVCHTDLDYYYNGVRTNHALPLALGHEISGRVIQAGAGAESWVGKAV 104 Magnetospirillu...
WP_011238811   8 TWQMTEPGK-LQKTRVPMPELGSGDVVVKIAGCGVCHTDLSYFYMGVPTVQKPPLSLGHEISGTII---GGEASMIGKEV 83  Aromatoleum aro...
CAA12244     100 IVPAVMPCGTCELCTSGHGTICRDQVMPGNDIQ--GGFASHVVVPARGLCPVDEARLAAAGLQLADVSVVADAVTTPYQA 177 Thauera aromatica
WP_011384543 105 IISAVIPCGQCDLCKRGKGTICRSQKMPGNDLQ--GGFATHITVPANGLCAVDEARLKAAGLELSEVSVVADALTTPYQA 182 Magnetospirillu...
WP_011238811  84 IVPAVIPCGECELCKTGRGNRCLAQKMPGNSMGiyGGYSSHIVAQSKYLCVVEN----RGDTPLEHLAVVADAVTTPYQA 159 Aromatoleum aro...
CAA12244     178 VLQAGVEPGDVAVVIGV-GGVGGYAVQIANAFGA-SVVAIDVDPAKLEMMSKHGAALTLNAREI-SGRDLKKAIEAHAKA 254 Thauera aromatica
WP_011384543 183 AVQAGIGQGDLVIVIGC-GGVGGYSVQVASAMGA-TVVALDIDPVKLEAVKAAGAKLTLNPKDFpSTREIKKEIGAFAKA 260 Magnetospirillu...
WP_011238811 160 AVRADLKKDDLVIVVGAaGGVGSFMVQTAKGMGAkAVIGIDINEEKLEMMKGFGADFIINPKDK-SAKEVKELFKGFCKE 238 Aromatoleum aro...
CAA12244     255 NGLRLT-RWKIFECSGTGAGQTSAYGLLTHGATLAVVGFTMDKVEVRLSNLMAFHARALGNWGCLPEYYPAALDLVLDKK 333 Thauera aromatica
WP_011384543 261 QGLRST-EWIIMECSGSVPGQQSAFDLMVHGCTICVVGYTMNKAEFRLSNLMAFHARALGNWGCPPDLYPGALDLVLSGK 339 Magnetospirillu...
WP_011238811 239 RGLPSNyGWKIFEVTGSKPGQELALSLLSFTGKLVIVGYGTAETNYMLSKLMAFDAEIIGTWGCPPDRYAAVRDMCLDGR 318 Aromatoleum aro...
CAA12244     334 IDLASFIERHPLDQIGEVFAAAHAHKLTRRAILTP 368 Thauera aromatica
WP_011384543 340 INVKNFVERRPLDSINDTFAAVHDHKLSRRAVLCP 374 Magnetospirillum magneticum
WP_011238811 319 IQLGPFVETRPMSQIEHVFDEAHHGKLKRRVILTP 353 Aromatoleum aromaticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap