Conserved Protein Domain Family
dearomat_oah

?
TIGR03200: dearomat_oah 
6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase
Members of this protein family are 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase, a ring-hydrolyzing enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA.
Statistics
?
PSSM-Id: 132244
View PSSM: TIGR03200
Aligned: 4 rows
Threshold Bit Score: 655.441
Threshold Setting Gi: 499558029
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA12245      17 LVDHNLV----PETVCPGVL-YEKRPARNLKGEVVPGLYNVWISLDNPKQYNSYTTDMVKGLILAFRAASCARDVASVVF 91  Thauera aromatica
WP_004514578  16 LNDHNLIdr-eVESLCDGMVkYEKRPAKRHDGSVAEGIYNAWIILDNPKQYNSYTTDMVKAIILAFRRASVDRSVNAVVF 94  Geobacter metal...
WP_011384542  17 LNDHNLV----PTTVVPGVL-YEKRPAKRADGTVAEGLYNAWITLDNQKQYNSYTTDMVKGVIMAFRDASNARDVSSVVF 91  Magnetospirillu...
WP_011238812  12 IKDHALMgeehFGTEAPSVL-FEKRPVTDPQGNVVPGLYAAWIILNNPKQYNSYTTEMVKAIIAGFQRASSDRTIVAAVF 90  Aromatoleum aro...
CAA12245      92 TAVGDKAFCTGGNTKEYAEYYAGNPQEYRQYMRLFNDMVSAILGCDKPVICRVNGMRIGGGQEIGMAADFTVAQDLANFG 171 Thauera aromatica
WP_004514578  95 TGVGDKAFCTGGNTKEYAEYYAGNPQEYRQYMRLFNDMVSAILGCDKAVISRVNGMRIGGGQEIGMACDFSIAQDLANFG 174 Geobacter metal...
WP_011384542  92 TGAGDKAFCTGGNTKEYAEYYAGNPQEYRQYMRLFNDMVSAILGCDKPVICRVNGMRIGGGQEIGMAADFSVAQDLAKFG 171 Magnetospirillu...
WP_011238812  91 TAVGDKAFCTGGNTAEYASYYAQRPNEYGEYMDLFNAMVDGILNCKKPTICRVNGMRVGGGQEIGMATDLTITSDMAIFG 170 Aromatoleum aro...
CAA12245     172 QAGPKHGSAAIGGATDFLPLMIGCEQAMVSGTLCEPFSAHKANRLGICMQIVPALKVDGKFIANPLVVTDRYLDEFGRII 251 Thauera aromatica
WP_004514578 175 QAGPKHGSAAIGGATDFLPLMVGCEQAMVSGTLCEPFSAHKAARLGIICDVVPALKVGGKFVANPTVVTDRYLDEYGRVV 254 Geobacter metal...
WP_011384542 172 QAGPKHGSAPIGGATDFLPVMIGCEQAMVSGSLCEPWSAHKAYRTGIIMDLVPALKVDGKFVANPLVITDRYLDEFGKIV 251 Magnetospirillu...
WP_011238812 171 QAGPKHGSAPDGGSTDFLPWMLNMEDAMYNCISCEPWSAYKMKSKNLITKVVPVLKKDGEWVRNPLVRTDAYVDD-GELV 249 Aromatoleum aro...
CAA12245     252 HGEFKTGDELAAGKELMKRGEIDLSLLDEAVEKLCAKLISTFPECLTKSFEELRKPKLDAWNRNKENSRAWLALNMMNEA 331 Thauera aromatica
WP_004514578 255 HGEFKAGAAFKEGQGQIKEGEIDLSLLDEKVESLCTKLLETFPECMTKSLEELRKPKLHAWNLNKENSRAWLALNMMNEA 334 Geobacter metal...
WP_011384542 252 HGESKTGAELAAGKELLKKGTIDLSLLDAKVEEICAKILHTFPDCFTKTIQELRKPKLNAWNANKENSRDWLGLNMMTEA 331 Magnetospirillu...
WP_011238812 250 YGEPVAADKAKAAKELIAQCTTDFAKLDEAVDALVWKFANLFPQCLIKSIDGIRGKKKFFWDQMKLANRHWLAANMNHEA 329 Aromatoleum aro...
CAA12245     332 RTGFRAFNEGNKETGRE-IEFTDLRQALAKGMPWTPELIESLM 373 Thauera aromatica
WP_004514578 335 RTGFRAFNEGTKETGRE-IDFVKLRQGLAKGTPWTEELIESLM 376 Geobacter metallireducens
WP_011384542 332 RTGFRAFNEGPKE-DRE-IDFVALRQALAKGAPWTPELIESLI 372 Magnetospirillum magneticum
WP_011238812 330 YLGFTAFNN-KKATGKDvIDFIKFRQLVAEGHAFDDAFAEQVL 371 Aromatoleum aromaticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap