Conserved Protein Domain Family
pucE

?
TIGR03198: pucE 
xanthine dehydrogenase E subunit
This gene has been characterized in B. subtilis as the Iron-sulfur cluster binding-subunit of xanthine dehydrogenase (pucE), acting in conjunction with pucC, the FAD-binding subunit and pucD, the molybdopterin binding subunit. The more common XDH complex (GenProp0640) includes the xdhA gene as the Fe-S cluster binding component.
Statistics
?
PSSM-Id: 132242
View PSSM: TIGR03198
Aligned: 3 rows
Threshold Bit Score: 262.094
Threshold Setting Gi: 499567793
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011248576  10 KVSLTFQINGQTRQVETYASVRLADVLREELGLTGTKVSCGIGRCGACAVLMDGKVVNSCLLMAFQATNVELQTIEGIta 89  Bacillus clausii
WP_010896922  15 KAPTNFFLNGVETKLTHDPAKRLIDLLRDDLTLTGTKRSCEIGRCGGCMVLVDGKAHNACLMMAYQCEGKEVVTIEGI-- 92  Bacillus halodu...
WP_003243276  13 KEQFRMTVNGQAWEVAAVPTTHLSDLLRKEFQLTGTKVSCGIGRCGACSILIDGKLANACMTMAYQADGHSITTIEGL-- 90  Bacillus subtilis
WP_011248576  90 sAENGVDPVQQAFLEEGGFQCGYCTPGMVVAAKALLNENQAPSDEEMAEALSGNLCRCTGYAGIIRAVRKAAKG 163 Bacillus clausii
WP_010896922  93 -AENELDPIQKAFLEEGGFQCGYCTPGMVVSLKAVFMEHEKPTFEQMKQGLSGNLCRCTGYGGIIRVLKHLCDG 165 Bacillus halodurans
WP_003243276  91 -QKEELDMCQTAFLEEGGFQCGYCTPGMIIALKALFRETPQPSDKDIEEGLAGNLCRCTGYGGIMRSACRIRRE 163 Bacillus subtilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap