Conserved Protein Domain Family
pucD

?
TIGR03196: pucD 
xanthine dehydrogenase D subunit
This gene has been characterized in B. subtilis as the molybdopterin binding-subunit of xanthine dehydrogenase (pucD), acting in conjunction with pucC, the FAD-binding subunit and pucE, the FeS-binding subunit. The more common XDH complex (GenProp0640) includes the xdhB gene which is related to pucD. It appears that most of the relatives of pucD outside of this narrow clade are involved in other processes as they are found in unrelated genomic contexts, contain the more common XDH complex and/or do not appear to process purines to allantoin.
Statistics
?
PSSM-Id: 132240
View PSSM: TIGR03196
Aligned: 2 rows
Threshold Bit Score: 1164.81
Threshold Setting Gi: 499754557
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011435291   3 LGIGRPVR-RPDGPDKVTGSFSYVGDLRVPGMVHARTLRSPHARARIRRVDVDAARRLPGVVGMVTAADVPGMATYGLIV 81  Frankia sp. CcI3
WP_003243174   1 MIINKPSRvRPDGRGKVTGELKYMTDLSFPGMLYGKVLRSAYPHAEIVSVCTIKAEKMEGVQAVVTHKDVPGLNRFGIVI 80  Bacillus subtilis
WP_011435291  82 ADQPVFAATEIRYAGEPVAAVAAVDVRTARRALAAIEVDYEPLAPSTDPDRVWQPDAEPLHPAGNLYREIELRHGDPD-- 159 Frankia sp. CcI3
WP_003243174  81 PDQPVLCEDRVRYVGDAIAAVAAETEEIAEAALELIQVEYKELEVMDSPEKALRPNAQRLHEDGNILHRAFFSNGDVEeg 160 Bacillus subtilis
WP_011435291 160 -ALGPVVVEDQYLVGMQDQAFLAPEAALAMPAADGGVDLRVATQWLHSDREQIAACLGLPEELVRLTLAGVGGAFGGRED 238 Frankia sp. CcI3
WP_003243174 161 fQASDTVFEETYELPRQMHTYMETEGGVAVPEDDGGFTMYAGTQHGYKDRFQLARIFDIPEEKIRIVSSPMGGSFGGKDE 240 Bacillus subtilis
WP_011435291 239 VTLQIHGALLARATGLPVRIAYDRVESFLGHPHRHPARMWFQHSATADGNLVSVRARLVLDGGAYASSSPAVLANAVTHA 318 Frankia sp. CcI3
WP_003243174 241 LNIQPYAALLALKSGRPVKIHQTRKESVRSGIKRHPMKITIKTGADHSGNLLAHDVKIVADTGAYATLGPAVLDFSVEHA 320 Bacillus subtilis
WP_011435291 319 AGPYRVPNAHLHGVVVRTNNPPCGAMRGFGVPQVTIGHEAQMDRLADALGMDPVDLRVRNAVRPGDVLPTGQVMGAPLPA 398 Frankia sp. CcI3
WP_003243174 321 AGPYRIPNIRTEGISVFTNNGVAGEFRGFGGNQITFALETHLDRLSGMLGIDPLELRRKNIRKPHDLGPLEHRIAPTDGA 400 Bacillus subtilis
WP_011435291 399 REVIEAVAsrplpPA---MPANVAvtalpggrpaaaePSRVRRGVGYALAYKNLLFSEGMDDSSvaRARLELAEDGtvRV 475 Frankia sp. CcI3
WP_003243174 401 AQVLNAIS-----KSpilKKTSRN-------------CGYLQRGTGAAITMHGGGLGFGRMDAA--GGRLSLSSEG--KI 458 Bacillus subtilis
WP_011435291 476 RLHSACAEVGQGFVTIAGQIARTELGV--EQVVLAPADTAVGS-AGSTSASRQTWMSGGAVRGACAAVADRLLARVARTA 552 Frankia sp. CcI3
WP_003243174 459 TASFGFEECGQGILAAIEQIVMEELGCaaEDISIVIGDTAKVPkSGSSTASRGTSMVWHAIQRLKKPFLAQLKKRAAEWS 538 Bacillus subtilis
WP_011435291 553 GlpaevveAPRRTLTVNAGEIvGV--EAGLRVPLAEALADGPIEAEYTFhHRRTSAlDAD-GqgdPHVAFAAAAHRAVVD 629 Frankia sp. CcI3
WP_003243174 539 G-------CSAENLIPGAAGL-RDknTKALVVTYKELAEKGPLAEETAF-DFPTTP-DPVvG---GHFLYSFGAAAVEVE 605 Bacillus subtilis
WP_011435291 630 VDVDLGLVRVVSMALAQDCGTVLNPLALRGQVEGGTAQGLGLAVMEELVTVDGVVVNPTFHDYLLPTIADVPDLDFVAVT 709 Frankia sp. CcI3
WP_003243174 606 VDLLTGDVKLIDCEHAIAAGPVVSPQGYRGQIEGGAAMALGYTLMEEAKMTDGRYAAENLDHYLIPGIKDVPDMKLIAIE 685 Bacillus subtilis
WP_011435291 710 HPQPDAPYGVKGVGEAPTCTATPAIIAAIRVAVGRDLRRVPVRPEDLV 757 Frankia sp. CcI3
WP_003243174 686 DLMKGDVYGPRGVGEIGTIAITPAIVKAVHDAVGCWINKLPISREELL 733 Bacillus subtilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap