1RM6


Conserved Protein Domain Family
4hydrxCoA_B

?
TIGR03195: 4hydrxCoA_B 
Click on image for an interactive view with Cn3D
4-hydroxybenzoyl-CoA reductase, beta subunit
This model represents the second largest chain, beta, of the enzyme 4-hydroxybenzoyl-CoA reductase. In species capable of degrading various aromatic compounds by way of benzoyl-CoA, this enzyme can convert 4-hydroxybenzoyl-CoA to benzoyl-CoA.
Statistics
?
PSSM-Id: 132239
View PSSM: TIGR03195
Aligned: 6 rows
Threshold Bit Score: 516.696
Threshold Setting Gi: 499557070
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1RM6_B         3 ILTDFRTHRPATLADAVNALAA-EATLPLGAGTDLLPNLRRGLGHPAALVDLTGIDGLATISTLADGsLRIGAGATLEAI 81  Thauera aromatica
WP_011471484   3 ALHPLRLVQPGTVNEAVAALVEnPEARLVAGGTDLLVNMRRGVQQPNLLVDASGIPEIKQLTLNADE-VTIGAGVTIATL 81  Rhodopseudomona...
WP_011384424   3 ILPDFRTLRPASLSDAVAALAV-PGAEPLAGGTDLLPNLRRGLGKPETLVDLTGITGFAAISVGADGtLRIGAGATLEAV 81  Magnetospirillu...
WP_011156239   3 ALNALNLLRPGSVDEAIAALLAhPGGWLLGGGTDLLVNMRRGVTQPETLIDTTGIAEIKQLVADGSG-LTIGAGVTLASL 81  Rhodopseudomona...
O33820         3 ILTDFRTHRPATLADAVNALAA-EATLPLGAGTDLLPNLRRGLGHPAALVDLTGIDGLATISTLADGsLRIGAGATLEAI 81  Thauera aromatica
WP_011237853   3 ALSEFSVLRPASAADAVRLRGEhPASRFIAGGTDLVPNLRRGLVDAEVVIDLTGVGEMRELQQQGDM-LRLGAGVTLATL 81  Aromatoleum aro...
1RM6_B        82 AEHDAIRTTWPALAQAAESVAGPTHRAAATLGGNLCQDTRCTFYNQSEWWRSGNGYCLKYKGDKCHVIVKSDRCYATYHG 161 Thauera aromatica
WP_011471484  82 ANDALIASRYRALAEAARTIAGPSHRKVGTVGGNLCLDTRCIYYNQSEWWRQANSYCLKNRGETCHVAPNGNRCHAAFSG 161 Rhodopseudomona...
WP_011384424  82 AEDARVLASWPVLAQAASLVAGPSHRAAATLGGNLCQDTRCVFYNQSEWWRSGNGFCLKYEGDKCHVVVKSDRCYATYHG 161 Magnetospirillu...
WP_011156239  82 AADGLVAARYPALSEAARAVAGPGHRKLGTVGGNLCLDTRCIYYNQSEWWRRANSYCLKNRGEICHVAPKGNRCHAAFSG 161 Rhodopseudomona...
O33820        82 AEHDAIRTTWPALAQAAESVAGPTHRAAATLGGNLCQDTRCTFYNQSEWWRSGNGYCLKYKGDKCHVIVKSDRCYATYHG 161 Thauera aromatica
WP_011237853  82 AADATVRTQLPALAQAAAAVAGPTHRASATLGGNLCLETRCQYFNQSESWRQGNDYCMKLAGDTCRVAPKSSRCYAAFSG 161 Aromatoleum aro...
1RM6_B       162 DVAPALMVLDARAEIVGPAGKRTVPVAQLFRESGAEHLTLEKGELLAAIEVPpTGAWSAAYSKVRIRDAVDFPLAGVAAA 241 Thauera aromatica
WP_011471484 162 DLAPALLVLRAEIDIAGPNGVRRIPLSEFYAEDGKAHLTLQPAEVVVKVRLP-TNQITSSYQKVRVRGAIDYPLAGVAVA 240 Rhodopseudomona...
WP_011384424 162 DVAPALMVLNASAEVVGPKGVRLVPVADLFVESGAAHLSLDHGEVLAALLVPpATGWTAAYSKVRVRDAIDFPLAGVAVA 241 Magnetospirillu...
WP_011156239 162 DLAPALLVLGAEVEIAGPDGRRRIPLGELYVEDGRAHLALRPGEVVVTVRLP-ADPLASRYVKVRQRGAIDYPLAGVAVA 240 Rhodopseudomona...
O33820       162 DVAPALMVLDARAEIVGPAGKRTVPVAQLFRESGAEHLTLEKGELLAAIEVPpTGAWSAAYSKVRIRDAVDFPLAGVAAA 241 Thauera aromatica
WP_011237853 162 DVAPALLALDAEIELLGPQGIRRLPLAEFYVDDGMRWLALGADELLFAVTVPlVAGRVSGYEKLRVRGAIDFPLAGVAVA 241 Aromatoleum aro...
1RM6_B       242 LQRDGDRIAGLRVAITGSNSAPLMVP-VDALLGGNWDDAAAETLAQLVRKTSNVLRTTITGVKYRRRVLLAISRKVVDQL 320 Thauera aromatica
WP_011471484 241 LSRSGPDIAQLRIALTGTNSRPFLLAgTDAFERRPLDDQMLKEIDRRVQQQVQPMRTTLMSANYRRLAAAGIARRLTTAL 320 Rhodopseudomona...
WP_011384424 242 LKRDGNAIAGLRVAMTGTNSAPLMVP-TDALWGRPWNDETAEALVQAVRKVSNVLKTTVAGVKYRRRVLLAVARRQMDYL 320 Magnetospirillu...
WP_011156239 241 LARSGSRLAQLRIALTGTNSRPFLLAeTAAFAQRSLDDALLREIDRLVQKQVQPMRTTLMPANYRRVVAAALASRITAEL 320 Rhodopseudomona...
O33820       242 LQRDGDRIAGLRVAITGSNSAPLMVP-VDALLGGNWDDAAAETLAQLVRKTSNVLRTTITGVKYRRRVLLAISRKVVDQL 320 Thauera aromatica
WP_011237853 242 LVRDGDTIGELRLACTGVSSRPEFVGgLDWLAGQPLDAAAFAVIARQIKRTIQPMETTTVSVPYRRRATPVLAKRLVGRL 321 Aromatoleum aro...
1RM6_B       321 WE 322 Thauera aromatica
WP_011471484 321 FN 322 Rhodopseudomonas palustris
WP_011384424 321 WN 322 Magnetospirillum magneticum
WP_011156239 321 FA 322 Rhodopseudomonas palustris
O33820       321 WE 322 Thauera aromatica
WP_011237853 322 WD 323 Aromatoleum aromaticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap